Details for Capsella Locus Carubv10012922m

Position : scaf_3 ( 5`- 6806681 .. 6812837 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012922m

Protein [Map View]
NLGLGEIAEQHWTRRCVSTMEEEVVDILSSSDCDDSSDSYTEESQESEGEIENPECENLPAVSPSSDADRKSKNVNDLLR
GNLVVQRQPLLPRVLSVSEGAAVCRKPFKPPCSHGYNSTGQLSRRLSARKRFVPWGSSTPVVVAIPTKLNISTDIEKDEE
EEVVCLPPDIEPLILWQSEDDGMSNVKTIMVHSLLVQFLRPHQREGVQFMFDCVSGLHGSENINGCILADDMGLGKTLQS
ITLLYTLLCQGFDGTPMVKKAIIVTPTSLVSNWEAEIKKWVGDRIQLIALCESTRDDVLSGIDSFTRPRSALQVLIISYE
TFRMHSSKFCQSESCDLLICDEAHRLKNDQTLTNRALASLTCKRRVLLSGTPMQNDLEEFFAMVNFTNPGSLGDAAHFRH
YYEAPIICGREPTATEEEKNLAADRSAELSSKVNQFILRRTNALLSNHLPPKIIEVVCCKMTTLQSTLYNNFISSKNLKR
ALADNAKQTKVLAYITALKKLCNHPKLIYDTIKSGSPGTVGFENCLEFFPAEMFSGRSGAWTGGDGAWVELSGKMHVLSR
LLANLRRKTDDRIVLVSNYTQTLDLFAQLCRERRYPFLRLDGSTTISKRQKLVNQLNDQTKDEFAFLLSSKAGGCGLNLI
GANRLVLFDPDWNPANDKQAAARVWRDGQKKRVYVYRFLSTGTIEEKVYQRQMSKEGLQKVIQHEKTDSSTRQGNLLSTE
DLRDLFSFHGDVRSEIHEKMSCIRCQNDTSGTENMEEGNENNVDGDACQIDQEDIGAFAKDAGCFNLLKNSERQVGTPLE
EDLASWGHHFTSKSVPDAILQASAGDEVTFVFTNQVDGKLIPIDSNVSPKLVESEEYNRNQTVNKRAFNKPQQRPREPLQ
PLPINETTKRVKLSTYKRLHVTSNIDDAQIQMSLQRPNQVSVNHDDDFV*

DNA
AATCTAGGACTTGGTGAAATAGCGGAGCAGCACTGGACTCGTAGGTGCGTGTCGACAATGGAGGAAGAAGTTGTTGACAT
CTTATCTTCTTCTGATTGCGACGATTCCAGCGATAGTTATACAGAAGAGTCTCAGGAATCGGAAGGAGAAATCGAAAACC
CTGAGTGCGAAAATCTTCCGGCGGTTTCTCCTTCATCCGACGCCGATCGGAAATCGAAGAACGTCAATGATCTTTTGAGG
GGGAATCTGGTCGTACAACGGCAGCCACTCCTTCCTCGGGTGCTTTCAGTTTCAGAAGGAGCGGCAGTTTGTAGGAAGCC
CTTCAAGCCTCCGTGTTCTCATGGTTATAATTCCACCGGACAACTTTCTCGTCGCCTTTCAGCTCGAAAACGGTTTGTCC
CTTGGGGTTCCTCAACTCCGGTTGTGGTTGCTATACCTACTAAGCTGAATATATCTACCGATATCGAGAAAGATGAAGAA
GAGGAAGTTGTTTGTCTGCCACCTGATATTGAACCCTTGATATTGTGGCAATCTGAAGACGATGGAATGAGCAATGTTAA
AACAATCATGGTGCATTCATTGCTCGTCCAATTTCTTCGCCCTCATCAAAGAGAGGGTGTCCAGTTCATGTTCGATTGTG
TTTCAGGACTACATGGTTCCGAAAATATAAATGGTTGCATTCTGGCTGATGATATGGGCTTGGGGAAGACATTGCAGTCC
ATTACTTTACTATACACGCTTCTTTGTCAAGGATTTGATGGGACGCCTATGGTTAAAAAGGCCATTATTGTTACACCAAC
GAGTCTTGTCAGTAACTGGGAAGCTGAAATTAAGAAATGGGTTGGTGACAGGATTCAACTTATAGCCCTCTGTGAAAGCA
CCAGAGATGATGTTTTATCTGGAATAGATAGTTTCACTCGGCCACGAAGCGCTTTGCAGGTACTTATCATTTCTTACGAG
ACATTCCGAATGCACTCATCCAAGTTCTGCCAGAGTGAATCCTGTGATCTTCTAATATGCGATGAGGCTCATAGGTTGAA
AAATGACCAGACACTAACTAACAGGGCTTTGGCTTCATTGACATGCAAACGTCGGGTTTTGTTGTCTGGAACTCCCATGC
AGAATGACTTAGAAGAGTTTTTTGCCATGGTCAACTTTACAAATCCAGGGAGTTTAGGTGATGCTGCCCATTTTCGCCAT
TATTACGAGGCACCTATTATATGTGGGAGAGAACCTACAGCCACTGAAGAAGAAAAAAACTTAGCTGCTGACCGCTCTGC
AGAACTGAGTTCAAAAGTCAATCAGTTTATTTTGAGGAGAACCAATGCATTGCTCTCAAATCACTTACCACCTAAGATAA
TTGAAGTAGTTTGTTGCAAGATGACTACTCTCCAGTCCACTTTGTACAACAATTTTATCAGCTCAAAAAATCTTAAAAGA
GCGCTTGCTGATAATGCAAAGCAAACCAAAGTTTTGGCTTATATAACAGCTCTGAAGAAGCTCTGCAATCATCCGAAGCT
AATCTACGATACAATAAAAAGCGGCAGTCCTGGAACTGTTGGGTTTGAGAATTGCTTAGAGTTTTTCCCTGCAGAAATGT
TCTCTGGGAGATCTGGAGCATGGACTGGGGGTGATGGTGCCTGGGTCGAGCTCTCTGGTAAAATGCATGTTCTCTCCAGA
CTTTTGGCTAACCTACGTCGGAAAACTGATGACCGCATAGTCCTTGTATCAAACTACACACAGACATTGGATCTTTTCGC
TCAACTCTGTCGTGAAAGAAGATATCCATTTCTGAGGCTGGATGGATCAACAACAATCAGCAAGAGGCAGAAGCTTGTTA
ACCAGTTAAACGACCAAACAAAGGATGAGTTTGCATTTCTCTTAAGCAGCAAGGCAGGTGGCTGTGGATTAAATTTAATC
GGTGCTAATCGACTTGTTTTGTTTGATCCCGATTGGAATCCTGCCAATGATAAACAAGCTGCTGCCAGAGTTTGGAGAGA
TGGGCAAAAGAAAAGAGTATATGTCTACAGGTTTCTTAGTACTGGAACTATTGAAGAAAAGGTTTATCAGCGCCAGATGT
CAAAAGAAGGGCTTCAAAAAGTTATTCAGCATGAAAAGACGGATAGCAGCACTAGACAGGGGAACTTACTTTCTACAGAA
GATCTACGAGATTTATTTTCCTTCCATGGGGATGTTAGGTCTGAAATCCATGAAAAGATGAGCTGCATCAGGTGCCAAAA
TGATACCTCTGGTACTGAAAATATGGAAGAAGGAAATGAGAACAACGTAGATGGCGATGCTTGCCAGATTGACCAGGAAG
ACATTGGCGCGTTCGCAAAAGATGCAGGATGCTTTAACTTGTTAAAAAACTCAGAGAGACAGGTGGGCACTCCATTGGAA
GAAGATCTAGCTAGCTGGGGTCATCATTTTACCTCAAAATCAGTTCCAGATGCTATACTGCAAGCTTCTGCCGGAGACGA
GGTTACATTTGTTTTCACAAACCAGGTAGATGGGAAACTCATTCCCATAGATTCAAATGTAAGTCCGAAACTGGTGGAGT
CCGAAGAGTACAACCGGAACCAAACTGTAAATAAACGTGCGTTTAACAAACCACAACAAAGACCTCGGGAACCGCTGCAA
CCTTTACCTATAAACGAGACTACGAAAAGAGTGAAGTTGTCTACTTATAAGCGTTTACACGTTACTAGTAACATAGATGA
TGCTCAGATTCAAATGTCTTTGCAAAGACCAAATCAAGTGTCTGTAAATCACGATGATGATTTTGTATGA