Details for Capsella Locus Carubv10012918m

Position : scaf_3 ( 5`- 2719879 .. 2724453 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012918m

Protein [Map View]
MEEGDSISAESLSLETLASIRSLIINADTSDSVISSVFDFLTGLLSRGDSAILHHALKLLSDLASRRKELAPHIFESVFS
NLLRLQNVAAEANHKRGAVESLVVLASLSERNHGIATELSKIDGEVFASICLGAPISYRLWVLRNAERFNVPSSVLFTLY
LGFTKDPYPYIREVALNGLTNICKAGDFNHAHAVEGCYTRAVELLGDAEDSVRSSAVRAVSVWGKVMIASKDEEMNRREC
TDAVFLQLCSIVRDMSVDVRVEVFRAFGIIGTASEIIILQTLSKKVLGAGKGKKPQNHLSNVSADVAAAAGVFIHGFEDE
FYEVREAAVDSFHSLSVNSIKFPDEAVYLLMDMLYDDYMVVRLKALEALHHIADLGNLKIQETYMPAFLDAIVDTSENIR
FEARNILKLAKLPDLKLVNKCVDDVLKSLEMYPQDEPDTLSALFHFGQNHANFLTSLVKRFSEKLGVASGNKSEFNSLHI
SASLMLIISAPLSNKLSIASIPPMAFSYSLAMLGKFSCGLQDIMDQDMLLAYLTHCAFLSASSGTEFNKGDIFCHAYRHG
DADLAGNAVLLPSKDTTNESKYMASEAELEIRNQALKFVNYILLKIKAAWLISQSGCSKEALQALRACKQELATLTPDSS
ISNGALQFMCQYIHVIELLAQVWSHLEYSRHISTCIAVELDMLMEEVEIKLMEIRCRFTGLAMEVSLVMELVIFCCLLRL
YRFETCCRLSYIEKLTSTISQLELHHEQQCTNPSDFLTETKKSLQEIGGSANINLCRLLHLIKIFSCFSPEQFTLSGNLQ
CVSVELEVPGNGPYSPISFLPGLPVAIQCEITLLNVPRDTCLWLRISRSDETCQFVYVDPNLYNSDGREKRFMFSAVTYM
TLRAVMFTLRVSIGIECMFEEDVCYRKRHPGPKHPVAYLCKEREVHLNLVSRT*

DNA
ATGGAGGAAGGCGACTCGATCTCTGCTGAATCACTCTCTCTCGAAACTTTAGCTTCTATTAGATCACTCATTATCAACGC
CGACACTTCCGACTCGGTAATTTCCTCGGTGTTCGATTTCCTTACTGGTCTTCTGAGTCGAGGGGACTCGGCGATTCTTC
ACCACGCTCTCAAGCTACTCTCCGACCTTGCCTCCCGGCGAAAGGAATTAGCACCACATATCTTCGAATCGGTCTTTTCC
AACTTACTCCGCCTTCAAAACGTGGCCGCAGAGGCGAACCACAAACGCGGCGCCGTCGAATCTCTTGTTGTGCTGGCTTC
GTTATCCGAAAGAAACCATGGCATTGCCACTGAGCTTTCCAAAATCGACGGCGAGGTATTTGCGTCGATTTGCCTCGGAG
CACCTATATCTTATCGGTTGTGGGTTCTTAGGAACGCGGAGAGGTTCAATGTCCCGTCATCCGTACTTTTCACCTTGTAT
TTAGGGTTTACCAAGGATCCGTATCCGTATATCAGAGAAGTAGCTCTGAATGGACTGACTAATATATGTAAGGCTGGCGA
CTTCAATCACGCTCATGCCGTAGAAGGTTGCTATACTCGTGCTGTTGAGCTTCTAGGCGATGCTGAAGATAGCGTCAGAT
CTTCTGCAGTTCGTGCCGTCAGTGTGTGGGGCAAAGTGATGATTGCATCCAAGGACGAAGAGATGAACAGAAGAGAGTGT
ACGGATGCTGTGTTTCTCCAGCTTTGTTCTATTGTGAGAGATATGAGTGTAGACGTGAGGGTTGAGGTCTTCAGGGCATT
TGGGATTATAGGAACTGCATCAGAAATCATTATATTGCAAACACTTTCTAAAAAAGTATTGGGAGCCGGAAAAGGGAAGA
AACCGCAGAATCATCTTTCGAATGTATCAGCTGATGTCGCTGCTGCAGCTGGAGTTTTCATCCATGGTTTTGAAGATGAA
TTCTACGAGGTACGGGAAGCTGCGGTTGACTCCTTCCACTCCCTCTCAGTAAATTCTATCAAATTCCCAGATGAAGCTGT
GTACCTATTGATGGATATGCTATACGATGATTATATGGTTGTCAGGTTGAAAGCTTTAGAGGCATTGCATCATATAGCAG
ACTTGGGGAACCTTAAGATACAGGAAACATATATGCCTGCCTTTTTGGATGCTATTGTTGATACTTCTGAGAACATTAGG
TTTGAGGCTAGAAACATTCTTAAACTGGCAAAGCTGCCTGATCTGAAGCTGGTCAACAAATGTGTTGATGATGTCCTAAA
AAGTTTAGAGATGTATCCACAGGACGAACCTGATACCTTGTCTGCCCTGTTCCATTTCGGACAAAATCACGCAAATTTCT
TAACCAGTCTGGTTAAGAGATTTAGTGAAAAGTTAGGGGTAGCTTCCGGAAATAAATCTGAGTTCAACAGCCTACATATA
TCTGCATCTCTGATGCTGATAATCTCAGCCCCTCTCTCAAACAAACTAAGCATCGCCTCCATTCCACCCATGGCTTTTTC
ATATTCACTTGCAATGCTGGGGAAATTCTCTTGTGGACTTCAGGATATAATGGATCAGGATATGCTTTTGGCTTACTTGA
CTCATTGCGCTTTTCTTTCTGCTTCTTCGGGTACAGAATTCAACAAAGGAGATATATTTTGTCATGCATATAGGCACGGT
GATGCAGATCTTGCTGGAAACGCTGTCCTACTACCAAGCAAAGATACAACTAATGAGAGTAAATACATGGCTTCCGAAGC
AGAACTGGAAATTAGAAATCAAGCACTCAAGTTTGTGAACTATATACTGTTGAAAATAAAGGCTGCCTGGTTGATATCAC
AATCAGGGTGCTCGAAAGAAGCACTCCAAGCGTTGAGGGCTTGCAAACAGGAGTTAGCAACTTTGACACCCGATTCTTCA
ATCTCCAATGGGGCATTACAGTTTATGTGTCAGTATATTCACGTAATAGAACTTCTCGCTCAGGTATGGTCTCATTTGGA
ATACTCAAGACACATCAGCACTTGTATAGCTGTAGAACTGGATATGCTGATGGAGGAGGTAGAGATCAAATTGATGGAGA
TAAGGTGTAGATTCACAGGCCTGGCGATGGAGGTGTCATTAGTAATGGAGCTAGTAATTTTTTGTTGCTTGTTAAGGCTA
TATAGATTTGAGACTTGCTGCCGCCTTAGCTACATTGAGAAGCTAACTTCAACTATATCTCAATTAGAGCTCCACCATGA
ACAACAATGCACCAACCCATCAGATTTTCTAACTGAAACTAAGAAGTCATTGCAAGAGATTGGGGGATCTGCTAATATAA
ATTTATGTAGACTGCTTCATCTCATCAAGATATTCAGTTGCTTCTCTCCGGAACAGTTTACGTTATCTGGTAATCTGCAG
TGTGTGAGCGTGGAGCTAGAGGTTCCTGGTAATGGTCCTTACAGTCCTATTTCCTTTTTGCCTGGTCTTCCAGTGGCTAT
TCAGTGTGAGATCACGCTGCTTAATGTGCCAAGGGATACCTGTTTGTGGCTGAGAATATCCAGAAGCGATGAAACTTGCC
AGTTTGTGTATGTGGATCCAAACCTCTACAATAGTGATGGGAGAGAGAAGAGGTTCATGTTTAGTGCAGTAACTTACATG
ACCCTGAGGGCTGTTATGTTCACATTGCGGGTCTCAATAGGGATAGAGTGTATGTTTGAAGAAGACGTTTGTTACAGAAA
ACGGCATCCTGGTCCCAAGCATCCAGTGGCCTATCTGTGTAAGGAAAGAGAAGTTCACCTCAACCTTGTTTCAAGAACAT
AA