Details for Capsella Locus Carubv10012917m

Position : scaf_3 ( 5`- 1743848 .. 1748885 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012917m

Protein [Map View]
MLKLFASTAYGSHHLTPAIRSNPVNSLLFKSLTQLTGWNRSTYELGLRAFSSESDSDTKSSAAIVSTKPCLDDCLTVIAL
PLPHKPLIPGFYMPIYVKDPEVLAALQESRRQQSPYAGAFLLKDDASSDSSSSSETENILEKLKGKELLNRIHEVGTLAQ
ISSIKGEQVILIGHRRLRITEMVTEDPLTVKVDHLKEKPYDKDDDVIKATYFEVMSTLRDVLSTTSLWRDQVRTYTKACP
PRLWHCLRHIGDFNYQKLADFGAGISGANKHQNQGVLEELDVHKRLELTLELVKKEVEINKIQESIAKTVEEKFRGERHR
ILLKEQLKAIKTELGVETDAKSALSEKFRGRIDPIKDKIPEHVLKVIEEELKKMQLLEASSSEYYVTSNYLDWLTVLPWG
NSSDENFDVSRAEKILDEDHYGLSDVKERILEFIAVGRLRGTSQGKIICLSGPPGVGKTSIGRSIARALDRKFFRFSVGG
LSDVAEIKGHRRTYIGAMPGKMVQCLKSVGTENPLVLIDEIDKLGVRCHNGDPASAMLELLDPEQNANFLDHYLDVTIDL
SKVLFVCTANVIDTIPGPLLDRMEVISLAGYITEEKVQIARDYLEKTAQRDCGINPEQVDVSDAALLFLIEKYCREAGVR
NLQKHIEKIFRKIALKLVRKGASLEVPENSDDVTDAEDSKSLAKTDLESPETSAEGPTVLTDELATGDSTERKTEQSLVV
AETVEKFMIDESNLADYVGKPVFHAEKIYEQTPVGVVMGLAWTSMGGSTLYIETTSVEEGEGKGGLHITGRLGVVMKESA
EIAHTVARRIMLEKEAENQFFAKSKLHLHVPAGATPKDGPSAGSTMITSLLSLAMKKPVRKDLAMTGEVTLTGRILAVGG
VKEKTIAAKRSGVKVIIFPEANRRDYDELAENVKERLDVHFVDEYDQIFELAFGYDH*

DNA
ATGCTGAAGCTCTTCGCTTCCACTGCCTACGGTTCACATCACCTCACTCCGGCTATTCGGTCTAACCCGGTTAACAGTCT
ATTGTTCAAGTCACTGACACAGCTAACCGGATGGAACCGGAGTACCTACGAGTTGGGTCTTCGTGCTTTCTCCTCCGAGT
CCGATTCCGACACGAAATCTTCTGCAGCGATTGTCTCAACTAAACCTTGCCTCGACGATTGTCTAACGGTTATAGCATTG
CCATTACCCCACAAGCCTCTTATTCCTGGCTTTTACATGCCAATCTATGTCAAGGATCCTGAAGTACTTGCAGCTTTACA
AGAGAGCAGAAGACAACAATCCCCATATGCGGGGGCTTTCCTTTTGAAAGATGATGCATCAAGTGATTCATCTTCTAGCT
CTGAAACAGAGAATATTCTAGAGAAGTTGAAAGGAAAAGAGCTGCTTAACAGGATTCATGAAGTTGGCACACTTGCTCAG
ATTTCAAGTATCAAAGGTGAGCAAGTCATCCTTATTGGTCACAGACGACTTAGAATAACAGAGATGGTGACTGAAGATCC
TCTAACCGTCAAAGTTGACCATTTAAAGGAGAAGCCATATGACAAGGACGATGATGTCATCAAGGCAACATACTTTGAAG
TTATGTCGACACTTAGGGATGTCTTAAGCACAACTTCACTCTGGAGAGATCAAGTTCGGACCTATACCAAGGCATGTCCT
CCTCGTCTTTGGCACTGCTTGCGACATATAGGTGACTTCAATTATCAAAAGTTAGCCGATTTTGGAGCTGGGATCTCAGG
CGCTAACAAACATCAAAATCAGGGGGTTCTTGAAGAACTGGATGTTCACAAACGTCTGGAGTTGACGCTAGAATTGGTGA
AAAAAGAAGTGGAAATTAACAAGATTCAAGAATCAATAGCAAAAACTGTTGAAGAAAAATTTAGAGGCGAGAGACATCGT
ATCTTACTGAAGGAGCAGCTCAAGGCTATAAAAACGGAGCTTGGCGTGGAGACAGACGCCAAATCTGCACTTTCTGAAAA
GTTTAGGGGAAGGATTGACCCTATTAAAGATAAGATTCCAGAACATGTACTAAAAGTCATAGAAGAAGAGCTTAAAAAAA
TGCAGCTTTTAGAAGCCAGTTCAAGCGAGTACTATGTGACCTCTAATTACCTCGATTGGTTGACTGTGTTGCCTTGGGGA
AATTCCAGTGATGAGAATTTTGATGTTTCACGGGCAGAAAAGATTCTTGACGAGGATCATTACGGATTATCTGATGTAAA
AGAAAGAATACTAGAGTTTATTGCTGTGGGAAGACTTAGAGGCACTTCACAGGGGAAGATCATTTGTCTCTCTGGCCCAC
CTGGAGTAGGTAAAACTAGCATTGGGCGTTCAATTGCACGTGCTCTTGACCGCAAGTTCTTCCGGTTCTCTGTTGGAGGA
CTATCCGATGTTGCTGAGATTAAGGGGCATCGTCGAACATATATTGGTGCCATGCCTGGAAAGATGGTGCAATGTCTAAA
GAGTGTGGGAACAGAAAATCCTCTTGTTCTGATCGATGAGATTGATAAGCTTGGAGTTAGGTGCCACAATGGCGACCCAG
CCAGCGCCATGTTGGAGCTTTTGGATCCAGAGCAGAATGCAAATTTTCTAGACCACTATCTCGATGTTACTATTGACTTA
TCAAAGGTTTTATTTGTATGTACAGCAAATGTGATAGATACGATTCCAGGTCCTCTGCTAGACAGAATGGAGGTGATTAG
TCTTGCAGGGTATATTACTGAGGAGAAAGTGCAAATTGCTAGAGACTATTTGGAGAAAACGGCGCAGAGAGATTGTGGCA
TTAACCCTGAACAGGTTGACGTGAGCGATGCAGCTCTTCTTTTCTTGATAGAAAAGTACTGCAGAGAAGCAGGAGTTAGA
AATCTCCAGAAGCATATTGAGAAGATTTTTCGTAAGATTGCTCTAAAGCTTGTGCGCAAAGGGGCATCCCTCGAAGTGCC
TGAAAATTCTGATGATGTTACTGACGCTGAAGATAGTAAATCTTTGGCCAAGACTGATTTGGAATCCCCTGAGACCTCTG
CAGAAGGACCCACTGTGTTGACAGATGAGTTGGCAACTGGGGATTCAACCGAACGAAAGACTGAGCAGAGCTTAGTGGTG
GCTGAAACGGTTGAAAAGTTTATGATTGATGAATCAAACCTTGCAGATTATGTAGGCAAGCCAGTGTTCCACGCAGAGAA
GATTTATGAACAGACACCCGTCGGGGTTGTAATGGGTCTAGCTTGGACATCCATGGGTGGCTCAACACTGTACATAGAGA
CAACCTCTGTAGAAGAAGGAGAAGGCAAAGGGGGACTTCATATAACGGGTCGGCTTGGGGTTGTGATGAAAGAAAGCGCA
GAGATAGCTCACACGGTTGCCAGAAGAATAATGCTCGAGAAAGAAGCTGAGAACCAGTTCTTTGCGAAATCCAAGCTTCA
TTTACATGTTCCTGCAGGAGCCACACCAAAAGACGGTCCAAGCGCAGGCAGCACCATGATAACTTCCTTGCTATCACTTG
CGATGAAAAAGCCTGTAAGGAAGGATCTTGCAATGACAGGAGAAGTCACTCTGACCGGTAGAATTCTTGCAGTTGGCGGA
GTGAAGGAGAAGACTATAGCCGCGAAACGGAGTGGAGTGAAGGTGATAATATTCCCGGAGGCTAACCGGAGAGATTATGA
TGAGCTGGCAGAAAACGTGAAAGAAAGGCTCGATGTTCATTTCGTCGATGAATATGACCAGATTTTCGAGCTAGCCTTTG
GCTATGACCATTAG