Details for Capsella Locus Carubv10012916m

Position : scaf_3 ( 5`- 6491830 .. 6496217 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012916m

Protein [Map View]
MEGSIEEQNKLPELKLDAKQAQGFLSFYKTLPNDSRAVRFFDRKDYYTAHGENSVFIAKTYYHTTTALRQLRSGSNALSS
VSISRNMFETIARDLLLERNDHTVELYEGSGSNWRLVKTGSPGNIGSFEDVLFANNEMQDTPVVVSIFPNFQEGRCVIGM
AYVDLTKRVLGLAEFLDDSRFTNLESSLIALGAKECIFPAETGKSNECKSLYDSLERCAVMITERKKHEFRGRDLDSDLK
RLVKGNIEPVRDLISGFDLATPALGALLSFSELLSDEGNYGNFTIRRYDISGFMRLDSAAMRALNVMESKTDANKNFSLF
GLMNRTCTAGMGKRLLHMWLKQPLVELDEIKTRLDIVQCFVEEAGLRQDLRQHLKRISDIERLVRSLERKRGGLQHIIKL
YQSTIRLPFIKTALQQYSGEFSSLISERYLKKLEALSDQDHLGKFIDLVEYSVDLDQLENGEYMISSSYDTTLASLKDQK
ELLEQQIHELHKKTAMELDLQVDKALKLDKAPQFGHVFRITKKEEPKIRKKLTTQFIVLETRKDGVKFTNTKLKKLGDQY
QSVVDDYRNCQKELVDRVVQTVTSFSEVFEDLAGLLSEMDVLLSFADLAASCPTPYCRPEITSSDAGDIVLEGSRHPCVE
AQDWVNFIPNDCRLMRGKSWFQIVTGPNMGGKSTFIRQVGVIVLMAQVGSFVPCDKASISIRDCIFARVGAGDCQLRGVS
TFMQEMLETASILKGATDKSLIIIDELGRGTSTYDGFGLAWAICEHLVQVKKAPTLFATHFHELTALAQANSEVAGNTVG
VANFHVSAHIDTESRKLTMLYKVEPGACDQSFGIHVAEFANFPESVVALAREKAAELEDFSPSSMIINNEESGKRKIRED
DPEEVSRGAARAHKFLKEFAAMPLDKMELKDSLQRVREMKDELEKDAADCHWLRRFL*

DNA
ATGGAGGGCAGTATCGAGGAGCAGAACAAGCTTCCGGAGCTGAAACTGGATGCAAAGCAGGCTCAAGGGTTTCTCTCGTT
CTACAAAACCCTACCAAATGACTCGAGAGCTGTTAGATTCTTTGATCGCAAGGATTATTATACAGCTCATGGTGAAAATT
CAGTTTTCATCGCAAAGACTTATTATCATACAACCACTGCTTTACGTCAGCTTAGGAGCGGATCAAATGCTCTTTCAAGC
GTAAGCATCAGTAGGAACATGTTTGAAACGATTGCTCGGGATCTTCTTCTGGAGCGAAATGATCATACCGTTGAGCTTTA
TGAGGGAAGTGGATCGAATTGGAGACTTGTGAAAACAGGTTCTCCTGGAAACATCGGCAGCTTTGAAGATGTTTTGTTTG
CAAACAATGAAATGCAGGACACACCAGTTGTTGTCTCCATATTTCCAAATTTTCAAGAGGGCAGATGTGTTATCGGAATG
GCCTATGTTGATCTGACTAAGCGAGTTCTTGGACTAGCTGAATTTCTTGATGATAGTCGTTTCACCAATCTGGAGTCTTC
ACTGATTGCTCTAGGCGCAAAAGAATGCATTTTTCCAGCCGAAACCGGAAAGTCTAATGAATGCAAAAGCCTGTATGATT
CTCTTGAGAGGTGTGCCGTGATGATAACAGAGAGGAAGAAACACGAGTTCAGAGGTCGAGATTTAGATTCAGATCTTAAG
AGATTGGTAAAGGGTAATATTGAACCTGTTAGAGATTTGATATCTGGGTTTGACCTTGCGACTCCTGCTCTAGGTGCATT
GCTCTCTTTCTCTGAACTTCTCTCGGATGAGGGTAACTATGGGAACTTCACAATCCGCAGATATGATATCAGTGGATTCA
TGAGACTTGACTCTGCAGCTATGAGGGCGTTGAATGTGATGGAGAGCAAAACTGATGCTAACAAAAATTTCAGTTTGTTT
GGTCTCATGAACAGAACATGTACCGCAGGGATGGGTAAGAGACTGCTTCATATGTGGCTGAAGCAACCACTCGTGGAGTT
GGATGAGATTAAGACAAGATTAGATATAGTTCAGTGCTTTGTTGAAGAAGCTGGGTTAAGGCAAGATCTTAGACAGCATC
TGAAGCGAATCTCAGATATTGAGAGGCTTGTGCGCAGTCTCGAAAGAAAAAGAGGTGGGTTGCAGCACATTATTAAACTC
TATCAGTCAACTATAAGGCTTCCCTTCATCAAAACAGCTCTGCAACAGTACAGCGGAGAATTCTCATCACTCATCAGTGA
GAGATACTTGAAAAAGCTTGAGGCTTTATCAGACCAAGATCACCTTGGCAAGTTCATTGATTTGGTTGAGTACTCTGTAG
ATCTTGACCAGCTAGAAAATGGAGAATACATGATATCGTCAAGCTATGACACCACATTGGCATCTCTGAAAGATCAGAAA
GAATTGCTAGAGCAGCAGATTCATGAATTGCACAAAAAGACGGCAATGGAACTCGATCTGCAGGTTGACAAGGCTCTTAA
ACTTGACAAAGCACCGCAATTTGGGCATGTCTTCAGGATCACAAAGAAGGAAGAGCCAAAGATCAGGAAGAAGCTGACGA
CACAGTTTATTGTGCTGGAAACTCGCAAAGATGGAGTGAAGTTCACAAACACAAAGCTTAAGAAACTGGGGGACCAGTAC
CAAAGTGTTGTGGATGATTATAGGAACTGTCAAAAGGAACTTGTTGATCGTGTAGTTCAGACTGTTACCAGTTTCTCTGA
GGTGTTTGAGGACTTAGCTGGGTTACTCTCTGAAATGGATGTTTTGTTAAGCTTCGCTGATTTGGCTGCCAGTTGCCCTA
CTCCATACTGTAGGCCAGAAATCACCTCTTCGGATGCTGGAGATATTGTACTAGAAGGAAGCAGACATCCATGTGTAGAA
GCTCAAGATTGGGTGAATTTTATACCAAATGATTGTAGACTCATGAGAGGGAAGAGTTGGTTTCAAATAGTAACAGGGCC
TAACATGGGAGGGAAGTCCACTTTCATTCGCCAGGTTGGTGTGATTGTGCTGATGGCTCAAGTTGGTTCCTTTGTTCCTT
GTGATAAAGCATCAATTTCCATTAGAGACTGCATCTTTGCCCGTGTAGGAGCAGGCGATTGTCAACTGCGTGGAGTATCT
ACTTTTATGCAAGAAATGCTTGAAACCGCATCGATATTGAAGGGCGCTACTGATAAGTCACTGATAATTATCGATGAACT
TGGTCGTGGAACATCAACCTATGATGGTTTTGGTTTAGCTTGGGCTATATGTGAGCATCTGGTTCAAGTAAAGAAAGCAC
CAACTCTGTTTGCTACTCACTTCCATGAGCTTACTGCCTTAGCTCAAGCAAACTCTGAGGTAGCTGGTAACACCGTTGGT
GTGGCAAACTTCCATGTCAGCGCTCACATTGACACTGAAAGCCGCAAACTTACCATGCTTTACAAGGTTGAACCAGGGGC
CTGTGACCAGAGCTTTGGGATTCATGTAGCAGAATTTGCCAACTTCCCTGAAAGCGTAGTGGCCCTCGCAAGAGAGAAAG
CTGCAGAACTGGAAGATTTCTCTCCGTCTTCCATGATAATCAACAATGAGGAGAGTGGGAAGAGAAAGATCAGGGAAGAT
GATCCAGAGGAAGTATCGAGAGGGGCAGCTCGGGCACACAAGTTTCTGAAAGAATTTGCAGCGATGCCACTTGATAAAAT
GGAGCTTAAAGATTCACTTCAACGTGTTCGTGAGATGAAAGATGAGCTAGAGAAAGATGCTGCAGACTGCCACTGGCTCA
GGCGGTTCCTGTGA