Details for Capsella Locus Carubv10012904m

Position : scaf_3 ( 5`- 4003494 .. 4009250 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012904m

Protein [Map View]
MEEVQPPVTPPIDPNGKRSEASLLDICEKVLSLDGSTCDEALKLFTETKRILSANMSNIGSGTREEVERFWFAFILYSVK
RLSVRKEGDDQLVSGDNGFNLCQILRALKLNIVDFFRELPQFVVKAGSVLGELYGADWENRLQAKELQANFVHLSLLSKY
YKRGYREFFLTYDANAEKNSANSSSYLPDSYRFGWLLFLALRNHAFSRFKDLVTCSNGLVSILAILIIHVPCRFRNFSIQ
DSSRFVKKGDKGVDLVASLCKIYDAAEDELRIVIDKANNLVETILKKKPSPASECRTDKLDNINPDGLTYFEDLLEETSI
STSLITLEKDYDDAVCSKGELDERVFINEEDSLLGSGSLSAGAVNITGVKRKIDALGSPARTFISPLSPHKSPAAKTNGI
SGANKLTATPVSTAMTTAKWLRAVICPLLPKPSPGLEHFLKSCDRDITNDVTRRAHIILEAIFPNSSLGAQCGGGSLQGV
DLMDDIWAEQRRLEALKLYYRVLEAMCKAEAQILHANNLNSLLTNERFHRCMLACSAELVLATHKTITMLFPAVLERTGI
TAFDLCKVIESFIRHEDSLPRELRRHLNSLEERLLESMVWEKGSSMYNSLIVARPALALEINQLGLLAEPMPSLDAIAAL
INFSEGVHHASTIQNHETCPGQNGGIRSPKRLCTDYRSILVERNSFTSPVKDRLLALGNVKSKMLPPPLQSAFASPTRPN
PGGGGETCAETGINIFFTKINKLAAVRINGMVERLQLSQQIRESVYCLFQHVLAQRTSLLFNRHIDQIILCCFYGVAKIS
QMTLTFREIIYNYRKQPQCKPLVFRSVYVDSLQCRRQGRIGPDHVDIITFYNEIFIPAVKPLLVELGPVRNDRAVEANNK
PEGQCPGSPKVSVFPSVPDMSPKKVSAVHNVYVSPLRGSKMDALISHSSKSYYACVGESTHAYQSPSKDLSAINNRLNK*

DNA
ATGGAAGAAGTTCAACCTCCAGTGACTCCGCCCATTGACCCTAATGGGAAAAGAAGCGAAGCGTCTCTATTGGACATTTG
CGAGAAAGTTCTATCTCTTGATGGGAGCACTTGTGACGAAGCTTTGAAGTTGTTTACAGAAACCAAACGAATTTTGTCAG
CAAACATGTCTAACATTGGAAGTGGAACGCGGGAGGAAGTAGAGAGGTTCTGGTTTGCGTTTATTCTCTATTCTGTGAAG
AGGCTTAGTGTGAGAAAAGAAGGGGATGATCAGTTAGTGTCTGGTGATAATGGGTTTAATCTATGTCAGATACTGAGGGC
TCTGAAGCTAAATATTGTGGACTTTTTTAGAGAGCTACCTCAGTTTGTGGTCAAGGCTGGATCTGTATTAGGTGAACTTT
ATGGCGCAGACTGGGAGAACAGACTTCAGGCAAAGGAGTTGCAGGCAAATTTTGTGCATCTTAGCCTTCTAAGCAAATAC
TACAAACGTGGGTACCGGGAATTCTTCTTGACATATGATGCAAACGCAGAAAAGAACTCAGCAAACTCTTCTAGCTATCT
GCCAGATAGTTATCGTTTTGGATGGTTACTCTTTTTGGCACTCCGAAACCATGCATTTAGTCGATTTAAGGACCTCGTGA
CATGCTCAAATGGCCTAGTTTCTATATTGGCTATTTTGATCATACATGTTCCTTGTCGATTTAGAAATTTCAGTATCCAA
GATTCTTCTCGCTTTGTTAAGAAAGGCGACAAAGGTGTAGACTTGGTTGCATCACTTTGCAAGATATATGACGCCGCAGA
GGATGAGTTGAGAATAGTAATTGACAAGGCAAATAATTTGGTAGAAACAATATTGAAGAAAAAACCATCTCCAGCATCCG
AATGCCGAACTGACAAGCTAGATAATATTAACCCAGATGGTTTGACATACTTTGAGGATTTACTGGAGGAGACGTCCATC
TCAACTAGCTTGATTACACTAGAAAAGGATTACGATGATGCAGTTTGTAGTAAAGGCGAACTTGATGAGAGGGTATTTAT
CAACGAAGAGGATAGCTTACTTGGATCTGGAAGTTTATCCGCAGGAGCTGTAAATATTACTGGTGTCAAGAGGAAAATTG
ATGCTTTGGGCTCACCTGCAAGGACATTTATAAGTCCACTTTCTCCTCATAAGTCACCTGCTGCGAAGACAAATGGTATC
AGCGGTGCTAACAAGTTGACAGCAACACCAGTGAGCACCGCAATGACAACTGCCAAGTGGCTCAGGGCTGTCATATGCCC
GCTTCTGCCAAAACCTTCTCCTGGATTGGAACATTTTCTTAAATCATGTGATAGGGATATAACAAATGATGTCACACGAA
GAGCACACATAATATTGGAAGCTATTTTTCCAAATAGTTCCCTTGGTGCCCAATGTGGAGGTGGAAGTTTGCAAGGTGTT
GACTTGATGGATGACATATGGGCAGAGCAGCGGAGATTAGAAGCTCTCAAGTTATACTACAGAGTTCTTGAGGCAATGTG
TAAAGCAGAAGCTCAGATTTTGCATGCAAATAATCTGAACTCGTTATTGACAAATGAGAGGTTCCATAGATGCATGCTTG
CTTGCTCAGCTGAATTGGTACTGGCTACCCACAAAACCATAACAATGTTGTTTCCAGCTGTTCTCGAGAGGACTGGGATC
ACAGCCTTTGATCTCTGTAAGGTAATAGAGAGTTTCATCCGACATGAGGATTCTCTGCCTAGAGAGTTGAGACGGCATCT
GAATTCACTGGAGGAACGGCTTCTAGAGAGTATGGTATGGGAGAAAGGATCGTCAATGTACAATTCTCTGATTGTTGCAA
GGCCAGCGCTTGCATTGGAGATAAATCAGCTCGGATTACTAGCTGAACCGATGCCATCCCTGGATGCAATTGCAGCACTT
ATTAACTTCTCTGAAGGGGTACATCATGCATCAACTATTCAAAACCATGAAACTTGTCCAGGACAAAATGGGGGGATTAG
ATCTCCCAAAAGATTATGTACTGATTACCGCAGCATCCTAGTTGAACGCAACTCCTTTACGTCACCAGTAAAAGATCGTC
TGTTGGCCTTAGGCAACGTGAAATCCAAGATGCTGCCACCTCCATTGCAGTCTGCATTTGCCAGCCCAACACGTCCCAAC
CCAGGAGGCGGAGGAGAAACTTGTGCAGAAACTGGGATCAATATTTTCTTCACAAAGATTAATAAATTGGCTGCTGTCAG
AATCAATGGAATGGTGGAAAGGCTACAGCTTTCGCAGCAAATTAGGGAGAGTGTATATTGTCTCTTCCAACATGTACTTG
CTCAGCGGACTTCTCTTTTATTCAATCGACACATTGACCAGATCATTCTCTGTTGCTTCTACGGGGTGGCCAAGATATCC
CAAATGACCCTGACTTTTAGGGAAATCATATACAACTACCGGAAACAACCACAGTGTAAACCATTAGTTTTCCGCAGCGT
TTATGTGGATTCGTTACAATGTCGCCGTCAAGGGAGAATAGGGCCAGATCATGTTGACATCATCACATTCTACAATGAAA
TATTTATTCCAGCCGTAAAGCCGTTGCTGGTGGAGCTAGGTCCTGTGAGAAACGACCGGGCAGTGGAAGCCAATAATAAG
CCTGAAGGTCAATGTCCTGGATCGCCAAAGGTGTCTGTGTTTCCAAGTGTTCCAGACATGTCCCCTAAAAAAGTATCTGC
AGTGCACAATGTTTATGTTTCTCCTCTTCGGGGATCAAAGATGGATGCTCTTATATCACACAGCTCGAAGAGTTACTATG
CTTGTGTTGGAGAGAGTACACATGCCTACCAGAGCCCTTCGAAGGACCTATCTGCCATCAACAATCGCTTGAACAAGTAA