Details for Capsella Locus Carubv10012902m

Position : scaf_3 ( 5`- 1597340 .. 1600905 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012902m

Protein [Map View]
MDSAKVKARVFGDSFVSFTGNDGSKKLEAIDQAKAFLMDLDSVATDRGSDSCGYCDLGSRVSDSEREPSLCEMKRENRDS
DAKFYKLSLGADEKNTGTASKEETRVPDYKSFLSEFDDYVASEKMGSKVSRALRNGFEVGDMVWGKVESHPWWPGQIFNE
AFASPSVRRMKKMGYVLVAFFGDSSYGWFDPSELIPFEPHVSEKSKQTDSSHFAKAMEEAMDEVGRRSALGLTCKCRNPS
NFGPTSFKGYFAVHVPDYEVRAIYSSKQIQKARDSFSSVQTLAFVKRCALAPQKCDSDSIKSFQKRVAVYAFRKAVFEEF
DETYEQAFRARSSVKTNEPLNRAPPRAPLSGSLVRAETLNKSKSSTKAMKVKDSTKQEKYHPKRREEAGYMTVQFGRVQT
SFHLQGINGSSVRNHVLQKRTQHLQTPRKHEQTGIVSMNFTSSSGDIPRKKSSVSTLSRDDDKGLAQESEVRMGEETALC
PDHEKFEAMTSLNQVETGMNSRFKEGSLQPFIERKCSAEVGNKEGNVLKRSSGEMNSENGPPEPMKKKKKNSKKESGSEL
NHYSPNKRKALSSGEAWAKKSSQLNSAKRNSKLDGLQLLSYLQALSLDPSFGSSDRSSIRAVRQFFLRFRLLVYQKSLAV
FSPFTTQPSNCAKTLSRTNEPLKARKKRLPSAHQQDVPTKKLKKTNQFKAMAFDKKSNQEATKRPSLGSFNIVRDRVGPA
PISAKPAIAQLEKNMAPSAKVLEPTMLVMMFPPGTSLPSTALLKARFGRFGQLDQSAIRVSWKSSICRVVFLSKLDAQTA
LRYASGSNSIFGNVNVTYFLRDMNALSASGDHELKNAKIDEPISEQPLNERLEQAPPVNQPNIQLKSCLRKPGNNVNGKH
GTARVKFTLGGQETETKFLVSVLPLSPQLSKPKPVDNEDHVEPPLNPSQHTVDISQQMIKLLTRCNDVVANATGLLGYVP
YHSL*

DNA
ATGGACTCTGCTAAGGTGAAGGCTAGGGTTTTTGGCGATAGTTTTGTTTCTTTTACTGGTAATGATGGCTCGAAGAAATT
AGAAGCGATTGATCAGGCCAAAGCTTTCCTTATGGACCTTGATTCGGTTGCTACAGACAGGGGAAGTGATAGTTGTGGAT
ATTGCGATTTAGGTTCTCGAGTGTCTGACAGTGAAAGGGAACCTAGTTTATGTGAGATGAAAAGAGAGAATAGAGACTCT
GACGCCAAATTTTATAAGCTCAGCTTGGGAGCTGATGAGAAGAACACAGGAACGGCTTCGAAGGAGGAAACGCGAGTTCC
GGACTACAAATCTTTCTTGTCTGAGTTCGATGATTATGTTGCAAGCGAGAAAATGGGTTCTAAAGTTTCTAGGGCGTTGA
GAAATGGGTTTGAAGTGGGAGATATGGTATGGGGAAAGGTAGAGTCACATCCTTGGTGGCCAGGTCAAATATTCAATGAA
GCTTTTGCGTCTCCCTCTGTTCGTCGTATGAAGAAGATGGGTTACGTTCTGGTTGCTTTTTTTGGAGATAGTAGTTATGG
CTGGTTTGATCCTTCTGAGCTTATTCCCTTCGAACCTCATGTCTCAGAGAAATCAAAGCAAACGGATTCGAGTCACTTTG
CAAAAGCTATGGAGGAAGCTATGGATGAAGTTGGTCGAAGGTCAGCTCTTGGGTTGACTTGTAAATGTCGGAATCCTTCT
AACTTTGGGCCTACTAGTTTTAAAGGTTACTTTGCTGTTCATGTGCCTGATTACGAAGTCCGAGCTATTTACTCTTCTAA
GCAGATTCAGAAAGCTAGAGATAGTTTTTCATCTGTTCAAACTCTAGCTTTCGTAAAGCGCTGTGCATTAGCACCTCAAA
AGTGTGATTCAGACAGCATAAAGTCTTTCCAGAAGAGAGTCGCAGTTTATGCTTTCCGCAAGGCAGTGTTTGAGGAGTTT
GATGAAACATATGAGCAGGCCTTCAGGGCAAGATCTTCAGTAAAGACAAATGAACCACTTAATAGAGCACCCCCTCGAGC
CCCATTGAGTGGCTCACTGGTCCGTGCAGAAACTCTGAACAAGTCGAAGAGCTCAACAAAAGCTATGAAAGTAAAGGATT
CTACTAAACAAGAAAAATATCATCCTAAAAGAAGAGAGGAAGCTGGTTATATGACAGTTCAATTTGGTCGGGTCCAAACA
TCTTTTCATCTTCAGGGCATCAACGGATCTTCAGTCAGGAATCATGTACTGCAGAAAAGGACTCAACATCTCCAAACTCC
GAGGAAACATGAGCAGACCGGGATTGTCAGCATGAACTTCACCTCTTCAAGTGGTGATATTCCTAGAAAGAAATCCTCTG
TTTCAACGCTCTCGCGTGATGATGACAAGGGTTTAGCTCAAGAATCAGAGGTGAGAATGGGAGAAGAAACTGCTCTATGT
CCTGACCATGAGAAATTTGAAGCAATGACCAGTCTTAACCAAGTTGAGACTGGCATGAATTCGAGATTCAAGGAAGGCTC
TCTCCAGCCCTTTATTGAGAGAAAATGTTCTGCAGAAGTTGGGAATAAGGAAGGCAATGTCCTGAAACGGTCTTCTGGCG
AAATGAATTCTGAGAATGGTCCTCCAGAGCCGATGAAGAAGAAGAAGAAGAATTCGAAGAAAGAGTCTGGGTCAGAGCTG
AACCATTATAGTCCAAATAAGAGGAAAGCTTTATCTTCTGGTGAAGCTTGGGCCAAGAAATCATCACAACTGAATTCAGC
AAAGAGAAACTCTAAACTTGATGGTCTACAGCTGTTGAGTTATTTGCAAGCTCTCTCGCTTGACCCTTCCTTTGGATCCT
CGGATAGAAGTTCTATTAGAGCTGTAAGACAGTTCTTTTTGCGTTTCCGATTGCTTGTTTACCAGAAAAGCTTGGCCGTT
TTTTCTCCTTTCACGACACAACCATCAAATTGTGCTAAGACTTTGAGCAGAACCAATGAACCATTAAAGGCCAGGAAAAA
ACGCTTGCCTTCTGCCCATCAACAAGATGTCCCAACTAAGAAGCTAAAGAAAACCAATCAGTTCAAAGCTATGGCTTTTG
ACAAGAAATCCAACCAAGAAGCAACGAAGAGACCAAGTCTTGGATCTTTTAATATAGTAAGAGACCGAGTTGGTCCAGCC
CCCATCAGTGCCAAACCGGCTATAGCTCAACTAGAAAAGAATATGGCTCCATCTGCAAAGGTACTTGAGCCAACAATGCT
GGTCATGATGTTTCCTCCTGGTACATCTCTCCCTTCCACCGCTCTGCTTAAGGCGAGGTTTGGACGCTTTGGACAGTTAG
ATCAATCAGCCATCAGAGTTTCCTGGAAATCCTCAATCTGCCGTGTTGTCTTCCTGTCTAAACTCGATGCGCAGACTGCT
TTAAGATATGCATCAGGAAGCAACTCTATATTTGGCAACGTGAATGTGACGTACTTTCTCCGCGACATGAATGCTCTCTC
TGCATCCGGAGATCATGAACTGAAGAACGCCAAGATAGACGAACCAATCAGTGAACAACCATTGAACGAGCGGCTAGAGC
AAGCACCGCCGGTTAACCAACCAAACATCCAGCTCAAGTCCTGTTTGAGAAAACCAGGAAATAATGTTAATGGTAAGCAC
GGTACAGCACGAGTGAAATTCACGTTGGGTGGGCAAGAAACAGAGACAAAGTTTTTGGTTTCCGTACTTCCTCTTTCTCC
ACAGTTGTCAAAACCGAAGCCTGTTGATAATGAAGACCACGTCGAGCCACCCCTAAACCCATCGCAGCATACGGTGGACA
TCTCCCAGCAGATGATAAAGCTGTTAACAAGGTGTAACGATGTTGTGGCTAACGCCACGGGTTTGTTGGGTTACGTCCCT
TATCATTCCTTATGA