Details for Capsella Locus Carubv10012901m

Position : scaf_3 ( 5`- 5010182 .. 5016604 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012901m

Protein [Map View]
TSYSRPILGRREDDSPERTTGHDFTRSLTFREHVSSEPFDSERLPATLASEIQRFLRIANLVESEEPRIAYLCRFHAFEI
AHHMDRNSTGRGVRQFKTSLLQRLEQDEEFTVGRRKEKSDVRELKRVYHSYKEYIIRHGAAFNLDNSQREKLINARRIAS
VLYEVLKTVTSGAGPQAIADRDSIRAKSEFYVPYNILPLDKGGVHQAIMHLPEIKAAVAIVRNTRGLPPPEDFQRHQPFV
DLFEFLQYAFGFQNGNVANQREHMILLLSNTIIRQPQKQSSAPKSGDEAVDALMKKFFKNYTNWCKFLGRKNNIRLPYVK
QEALQYKTLYIGLYLLIWGEASNLRFMPECLCYIFHHMAYELHGVLTGAVSMITGEKVLPAYGVGHESFLVNVVTPIYRV
VEKEADKNKNGTADHSMWRNYDDLNEFFWSPECFEIGWPMRVNQGDGEECLDGQFQHDFFCVESSDTSKPGRWRGMLRFR
KQTKKTDEEIEDDEELGGLSEEQTKPTSRWLGKTNFVETRSFWQIFRSFDRMWSFFVMSLQALIIMACHDVGSPLQMFNA
DIFEDVMSIFITSAILKLIKGILDIIFKWKARNTMPINEKKKQMVKLGFAAMWTIILPVLYAHSRRKYMCYFTDYKTWLG
EWCFSPYMVAVTIYLTGSAIELVLFFVPAISKYIETSNHRIFKTLLWWGQPRLYVGRGVQETQVSQFKYTFFWILVLLTK
FAFSYAFEIKPLIEPTRLIMKVGVRNYEWHEIFPSVKSNAAAIVAVWAPIMVVYFMDTQIWYSVYCTIFGGLYGVLHHLG
EGSDGQKNSMAKFVLGTRFDDDADVIRALSIAKDYVGKDEVLYRRIRKDEYMYYAVKECYESLKYILQILVVEGSEEQLQ
VEKSEELHGKLVKALQDIFELVTNDMMIQRFLLLLTVKDSAMDIPENLEARRRISFFATSLFMDMPDAPKVRNMMSFRFA
FTTLP*

DNA
ACTAGTTACTCACGCCCTATTCTGGGTCGTCGTGAAGATGATTCACCAGAACGAACAACCGGGCACGATTTCACGAGATC
CCTAACTTTTCGGGAACATGTTTCGTCGGAGCCTTTTGATAGCGAGAGGCTTCCTGCCACATTAGCCTCAGAGATTCAGC
GGTTTCTTCGTATAGCTAATTTGGTTGAGTCTGAGGAACCTCGTATTGCTTATCTTTGCCGGTTTCATGCTTTCGAGATA
GCTCACCACATGGATAGGAACTCTACGGGAAGAGGTGTACGGCAGTTCAAAACTTCACTTCTTCAAAGGCTTGAACAGGA
TGAAGAGTTTACTGTGGGAAGAAGGAAGGAGAAGAGTGATGTTCGGGAGCTCAAACGTGTTTATCATTCTTACAAGGAGT
ACATTATTAGACATGGTGCAGCATTCAATCTCGATAATAGTCAGCGAGAGAAGTTGATTAACGCACGCAGAATTGCTTCT
GTTTTGTATGAAGTTCTTAAGACAGTCACAAGTGGTGCTGGCCCGCAGGCCATTGCGGATAGAGATAGTATTCGTGCAAA
ATCTGAGTTCTATGTGCCATATAACATTCTTCCTCTTGATAAAGGAGGGGTACACCAAGCCATCATGCATCTGCCTGAGA
TTAAAGCTGCTGTTGCAATTGTACGTAACACTCGCGGGTTGCCTCCTCCAGAGGATTTTCAGAGACACCAGCCTTTTGTG
GATTTATTTGAATTCCTTCAGTATGCATTTGGGTTCCAGAATGGAAATGTTGCCAATCAGAGAGAGCATATGATCCTACT
ACTCAGTAACACCATAATACGTCAACCTCAAAAGCAGTCTTCAGCACCGAAGTCTGGTGATGAGGCAGTAGATGCGTTGA
TGAAGAAGTTTTTTAAGAACTACACAAACTGGTGCAAATTTCTTGGGAGGAAAAATAACATCAGGTTGCCTTACGTGAAA
CAGGAAGCCCTACAATATAAAACACTGTATATAGGACTCTACCTTCTCATATGGGGAGAGGCGTCAAACTTGAGGTTCAT
GCCAGAGTGCCTGTGTTATATTTTCCACCATATGGCATATGAATTGCATGGAGTTTTAACTGGTGCAGTCAGTATGATAA
CTGGGGAGAAGGTTCTGCCAGCATATGGTGTAGGACACGAATCTTTCCTTGTGAATGTAGTTACCCCCATATACAGGGTT
GTCGAAAAGGAAGCTGATAAGAACAAGAATGGAACTGCTGATCATTCTATGTGGAGAAACTATGATGATCTGAACGAGTT
CTTCTGGTCTCCCGAATGCTTTGAAATAGGTTGGCCAATGCGAGTGAACCAGGGAGATGGCGAGGAATGCTTAGATGGCC
AATTTCAGCACGATTTTTTCTGTGTAGAATCATCAGATACCAGTAAGCCAGGGAGGTGGCGAGGAATGCTTAGATTTCGC
AAGCAGACAAAGAAAACTGATGAAGAGATAGAGGATGACGAAGAACTTGGGGGTCTCAGTGAGGAACAAACTAAACCAAC
CTCAAGATGGCTGGGGAAGACAAATTTTGTAGAGACTCGTTCCTTTTGGCAGATTTTTCGAAGTTTTGACAGAATGTGGA
GCTTCTTTGTTATGTCTCTACAGGCATTAATAATTATGGCTTGTCATGATGTGGGATCTCCACTCCAAATGTTTAATGCC
GATATATTTGAAGACGTCATGAGCATTTTCATTACCTCTGCAATTCTAAAGCTTATAAAAGGTATTCTTGACATAATCTT
CAAATGGAAGGCCAGAAACACTATGCCAATCAATGAAAAGAAGAAGCAGATGGTGAAGTTGGGGTTTGCTGCGATGTGGA
CTATAATTCTACCAGTGCTATATGCTCATTCAAGAAGAAAATACATGTGTTATTTTACAGATTACAAAACTTGGCTTGGT
GAATGGTGTTTTTCTCCATATATGGTGGCTGTCACGATATACCTGACAGGAAGTGCTATTGAATTGGTCTTGTTTTTCGT
TCCTGCCATCAGCAAATACATTGAGACCTCCAATCATCGCATCTTCAAAACTTTGTTGTGGTGGGGACAGCCTAGGTTAT
ATGTTGGGCGAGGAGTGCAAGAAACTCAAGTGTCACAGTTCAAATACACCTTCTTTTGGATTCTAGTTCTCCTGACCAAG
TTTGCTTTCAGCTATGCATTTGAGATAAAGCCTCTAATAGAACCTACGCGACTAATAATGAAAGTTGGCGTGCGGAACTA
TGAGTGGCATGAAATTTTCCCATCAGTGAAGAGTAATGCTGCTGCAATTGTGGCAGTATGGGCACCGATCATGGTGGTCT
ATTTCATGGATACCCAAATATGGTATTCAGTTTACTGTACGATCTTTGGTGGGCTGTATGGAGTTCTGCATCACCTTGGT
GAGGGGTCTGACGGCCAGAAAAATAGTATGGCCAAGTTTGTCTTGGGAACTAGATTTGATGACGATGCCGATGTCATCAG
AGCTCTGAGCATTGCAAAAGATTATGTCGGGAAGGATGAGGTTCTCTACCGAAGGATTCGGAAAGATGAGTACATGTACT
ACGCAGTAAAAGAATGCTATGAATCTTTGAAGTACATTCTTCAGATTCTTGTTGTTGAAGGAAGTGAAGAGCAACTCCAG
GTTGAGAAAAGTGAAGAACTGCATGGTAAACTTGTAAAGGCTCTTCAGGATATCTTTGAGCTAGTAACAAATGATATGAT
GATCCAGCGTTTTCTGTTATTGTTAACCGTCAAAGATAGTGCAATGGACATACCAGAGAACTTAGAAGCTCGGAGGCGCA
TATCTTTCTTTGCTACTTCACTTTTCATGGATATGCCTGATGCTCCGAAAGTACGCAATATGATGTCATTCAGGTTTGCC
TTCACGACTTTACCTTAG