Details for Capsella Locus Carubv10012900m

Position : scaf_3 ( 5`- 1135318 .. 1142231 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012900m

Protein [Map View]
MISSKNGAAMISRPVFLSDRVDEVFSRKLDLSVSSSSSSSLLQQFNKTHEGDDDARLGLAHQLYKAGEFKQALEHSNMVY
QRNPLRTDNLLLIGAIYYQLQEYDMCIARNEEALRIQPQFAECYGNMANAWKEKGDTDRAIRYYLIAIELRPNFADAWSN
LASAYMRKGRLSEATQCCQQALSLNPLLVDAHSNLGNLMKAQGLIHEAYSCYLEAVRIQPTFAIAWSNLAGLFMESGDLN
RALQYYKEAVKLKPAFPDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNCAMAFGNIASIYYEQGQLDLAIRHYKQAISR
DPRFLEAYNNLGNALKDIGRVDEAIRCYNQCLALQPNHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNLA
IIYKQQGNYSDAISCYNEVLRIDPLAADALVNRGNTYKEIGRVTEAIQDYMHAITFRPTMAEAHANLASAYKDSGHVEAA
ITSYKQALLLRPDFPEATCNLLHTLQCVCCWEDRSKMFAEVESIIRRQINMSVLPSVQPFHAIAYPIDPILALEISRKYA
AHCSIIASRFGLPPFTHPAGLPVKLEGGFKRLRIGYVSSDFGNHPLSHLMGSVFGMHNRENVEVFCYALSANDNTEWRQR
IQSEAEHFLDVSAMPSDAIAKIINEDKIQILINLNGYTKGARNEIFAMQPAPIQVSYMGFPGTTGATYIDYLVTDEFVSP
LQYAHIYSEKLVHLPHCYFVNDYKQKNQDVLDPNSKPKRSDYGLPEDKFIFACFNQLYKMDPEIVNTCALWLLRFPAAGE
MRFRTYAAAQGVQPDQIIFTDVAMKSEHIRRSVLADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLAT
GLGHEMIVNSLEEYEEKSVSLALNKPKLEALTKELRASRLTCPLFDTTRWVKNLERSYFKMWNIHCSGQQPQHFKVLEND
LEFPHDR*

DNA
ATGATCTCGTCTAAGAACGGAGCTGCGATGATCTCTCGACCTGTGTTTCTTTCGGATCGAGTTGATGAAGTCTTCTCTAG
AAAGCTTGATTTGTCTGTTTCGTCTTCTTCTTCTTCGAGTCTTCTCCAGCAGTTCAATAAGACCCATGAAGGTGATGATG
ACGCACGCCTGGGTCTTGCTCATCAGCTGTACAAAGCAGGCGAGTTCAAACAAGCCTTAGAGCACAGCAACATGGTTTAC
CAGAGAAACCCATTACGTACTGATAATCTTCTTCTTATTGGTGCTATCTATTACCAACTCCAAGAGTATGATATGTGCAT
AGCAAGAAATGAAGAAGCTCTTCGTATTCAACCTCAGTTTGCTGAGTGTTACGGAAATATGGCAAACGCATGGAAGGAAA
AAGGGGACACTGATCGAGCAATCCGCTACTACTTAATTGCAATTGAGCTGAGGCCCAACTTTGCTGATGCTTGGTCGAAC
TTGGCAAGTGCCTACATGCGGAAGGGAAGACTGAGCGAGGCAACACAATGCTGTCAGCAGGCCCTCTCATTGAACCCACT
TCTGGTTGACGCACATAGTAATCTGGGGAATCTGATGAAGGCTCAAGGGTTGATTCATGAAGCATACAGTTGTTACCTTG
AAGCTGTTCGCATACAACCAACATTTGCTATTGCATGGTCGAATCTTGCTGGTCTTTTCATGGAGTCAGGTGATCTTAAT
AGAGCCCTTCAATACTACAAGGAAGCTGTGAAGTTAAAACCTGCATTCCCTGATGCATATTTAAATCTAGGAAATGTGTA
TAAGGCTCTAGGGAGACCTACGGAAGCAATCATGTGTTATCAGCATGCGTTACAGATGAGGCCAAATTGTGCAATGGCAT
TTGGGAATATAGCCAGTATATACTATGAGCAAGGTCAACTAGATTTAGCAATTCGACACTACAAGCAGGCCATCTCCCGA
GATCCGCGATTTTTAGAGGCGTACAACAACTTGGGTAATGCATTGAAGGATATTGGACGAGTCGATGAAGCAATTCGGTG
TTATAATCAATGTCTTGCTTTACAACCAAATCATCCACAAGCAATGGCCAATCTTGGAAATATTTATATGGAGTGGAATA
TGATGGGTCCTGCTTCCTCATTATTCAAGGCTACTCTGGCTGTAACGACAGGGCTATCTGCTCCGTTCAATAACCTTGCA
ATAATTTACAAGCAACAGGGAAATTACTCGGATGCTATATCCTGCTATAATGAGGTTCTTCGTATTGACCCATTGGCAGC
TGATGCCCTGGTTAATAGAGGGAATACTTACAAAGAGATTGGGAGGGTAACTGAAGCAATTCAGGATTACATGCATGCTA
TTACTTTCCGGCCTACAATGGCTGAAGCTCATGCAAATCTGGCCTCAGCTTACAAGGATAGTGGGCATGTGGAAGCTGCC
ATTACGAGCTATAAGCAGGCCTTGCTATTACGACCAGACTTCCCAGAAGCAACGTGCAACCTTCTGCACACCTTACAGTG
TGTATGCTGTTGGGAAGACCGGAGCAAAATGTTTGCTGAAGTTGAAAGCATTATTAGGAGGCAAATAAATATGTCGGTCC
TCCCTAGTGTCCAGCCCTTCCATGCAATAGCATATCCTATTGATCCTATTCTTGCCCTTGAAATCAGTCGTAAATATGCT
GCACACTGCTCCATAATCGCTTCTCGTTTTGGACTACCTCCTTTTACTCATCCAGCTGGGCTCCCTGTAAAACTTGAGGG
GGGATTTAAGAGATTAAGGATTGGATATGTGAGCAGTGATTTTGGTAATCATCCATTGTCACACCTCATGGGCTCAGTGT
TTGGGATGCACAACAGAGAAAACGTTGAGGTTTTCTGCTATGCATTGAGTGCCAATGATAATACTGAGTGGAGACAGCGT
ATCCAGTCAGAAGCCGAGCATTTCCTGGACGTTTCTGCTATGCCATCCGATGCTATTGCCAAAATTATAAATGAAGACAA
AATCCAGATCCTTATTAATCTAAACGGTTACACCAAGGGAGCTAGAAATGAAATATTTGCCATGCAGCCTGCACCGATCC
AGGTTTCATATATGGGCTTCCCTGGTACAACTGGGGCAACCTATATTGACTATCTAGTGACTGACGAGTTTGTGTCTCCT
CTGCAATATGCACATATTTACTCAGAGAAGCTGGTCCATCTTCCCCATTGTTACTTTGTGAATGATTACAAGCAGAAAAA
TCAGGATGTGTTGGATCCAAATTCTAAACCCAAACGATCAGACTATGGACTTCCTGAAGACAAATTCATATTTGCATGCT
TCAACCAACTGTACAAAATGGATCCTGAGATCGTTAATACATGTGCTCTTTGGCTTCTACGTTTTCCAGCAGCTGGAGAG
ATGAGGTTTCGCACATATGCTGCTGCCCAAGGAGTACAGCCTGATCAGATTATCTTCACTGATGTTGCCATGAAGAGTGA
ACATATCAGACGAAGTGTCCTTGCTGATGTAATCCTTGACACGCCTCTGTGCAACGGACACACAACGGGAACAGATGTGC
TGTGGGCTGGTGTACCTATGATAACATTACCACTTGAGAAAATGGCAACTCGAGTGGCTGGATCACTCTGCCTTGCAACT
GGTCTGGGCCATGAGATGATAGTTAACAGCTTGGAGGAGTACGAAGAGAAGTCTGTCTCTTTGGCACTGAACAAGCCAAA
ACTTGAGGCATTGACTAAGGAATTGAGGGCTAGCCGCTTAACATGTCCTCTATTTGACACCACCCGCTGGGTGAAGAATC
TGGAGAGGTCATACTTCAAAATGTGGAACATCCATTGCTCTGGACAGCAGCCACAACACTTCAAGGTGTTGGAAAACGAC
CTAGAATTCCCACATGACAGATGA