Details for Capsella Locus Carubv10012899m

Position : scaf_3 ( 5`- 5138215 .. 5142598 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012899m

Protein [Map View]
MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQELYELSAEYEGKREPKKLEELG
SVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIKKLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDA
LKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANLYYNQIE
NLMFELSMWRCTDEFRARADELHRNSRKDAAKHYIEFWKTIPPTEPYRVILGDVRDKLYHTRERSRQLLSNGISDIPEEA
TFTNVEQFLEPLELCYRSLCSCGDRPIADGSLLDFLRQVSTFGLSLVRVDIRQESERHTDVLDAITKHLGIGSSYRDWSE
EGRQEWLLAELSGKRPLFGPDLPKTEEIADVLDTFKVISELPSDCFGAYIISMATSPSDVLAVELLQRECHVKKPLRVVP
LFEKLADLEAAPAAVARLFSIDWYKNRINGKQEVMIGYSDSGKDAGRLSAAWELYKAQEELVKVAKEYGVKLTMFHGRGG
TVGRGGGPTHLAILSQPPDTVNGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPISPKPEWRALLDEMAVV
ATEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVWLGFGAAFRFAIK
KDVRNLHMLQDMYKNWPFFRVTIDLIEMVFAKGDPGIAALYDKLLVSEDLWAFGEKLRANFEETKNLVLQTAGHRDLLEG
DPYLKQRLRLRDSYITTLNVCQAYTLKRIRDPNYNVTLRPHISKEIMQSSKSAQELVKLNPTSEYAPGLEDTLILTMKGI
AAGLQNTG*

DNA
ATGGCGGGTCGGAACGTAGAGAAGATGGCATCGATTGATGCTCAGCTTCGGCAACTTGTTCCTGCTAAAGTCAGTGAAGA
CGATAAGCTTATTGAGTATGATGCTCTTCTCCTCGATCGTTTTCTCGACATTCTCCAGGATTTACACGGCGAGGATCTCC
GTGAAACGGTTCAAGAGCTATACGAGCTTTCTGCTGAGTATGAAGGGAAGCGTGAACCTAAGAAGCTTGAGGAACTAGGG
AGTGTTCTAACGAGTTTGGATCCTGGTGACTCCATTGTTATCTCCAAGGCTTTCTCTCACATGCTTAACTTAGCCAACTT
GGCTGAAGAGGTGCAGATTGCTCACCGCCGCAGGATCAAGAAGCTCAAGAAGGGTGATTTCGTTGATGAGAGCTCTGCAA
CTACTGAATCCGATATCGAAGAGACGTTCAAGAGACTCGTTTCTGATCTTGGCAAGTCTCCTGAAGAGATATTTGATGCC
CTGAAGAATCAGACTGTGGATTTGGTTTTGACTGCTCATCCTACTCAGTCTGTGCGTAGATCATTGCTTCAAAAGCATGG
GAGGATAAGAGACTGTCTTGCCCAACTGTATGCAAAGGACATTACTCCTGATGACAAGCAGGAGCTCGATGAGTCTCTGC
AAAGAGAGATTCAAGCTGCATTCCGTACCGATGAGATTAGAAGAACACCTCCAACCCCACAAGATGAAATGAGAGCTGGA
ATGAGTTATTTCCACGAGACAATTTGGAATGGTGTCCCCAAGTTCTTGCGTCGTGTGGATACAGCTCTGAAAAACATTGG
GATTGATGAACGTGTCCCTTACAATGCCCCATTGATCCAATTCTCTTCATGGATGGGCGGTGATCGTGATGGTAATCCGA
GGGTTACACCTGAGGTCACCAGAGATGTGTGCCTGTTGGCTAGAATGATGGCTGCAAATCTCTATTATAACCAAATCGAG
AACCTGATGTTTGAGTTGTCTATGTGGCGTTGCACTGATGAGTTCCGTGCCCGGGCTGATGAACTCCACAGGAACTCAAG
GAAAGATGCAGCAAAACACTACATAGAATTTTGGAAGACAATTCCTCCAACTGAGCCATATCGTGTGATTCTTGGTGATG
TGAGGGATAAACTGTATCACACACGTGAGCGCTCTCGTCAATTGCTGAGTAACGGAATCTCTGACATTCCTGAAGAAGCT
ACTTTCACCAATGTGGAACAGTTCTTGGAGCCTCTTGAGCTCTGTTACCGTTCACTTTGTTCATGTGGTGACCGCCCAAT
AGCTGATGGAAGCCTTCTTGATTTCTTGAGGCAAGTCTCTACCTTTGGACTCTCCCTTGTGAGAGTTGACATTAGGCAAG
AGTCTGAACGCCACACAGATGTCTTGGATGCTATCACCAAGCATTTGGGCATCGGTTCCTCCTATAGAGACTGGTCTGAA
GAAGGCCGACAGGAATGGCTTCTAGCTGAACTAAGTGGAAAGCGTCCACTTTTCGGACCTGATCTTCCCAAAACCGAAGA
AATTGCTGATGTCCTCGACACATTCAAAGTCATATCTGAGCTTCCTTCAGACTGTTTTGGAGCTTACATTATATCTATGG
CAACTTCACCTAGTGATGTGCTTGCGGTTGAGCTTTTGCAGCGTGAATGCCATGTGAAAAAGCCACTTAGAGTTGTTCCA
CTCTTTGAGAAGCTAGCTGATCTTGAAGCAGCTCCTGCAGCCGTTGCTAGACTCTTTTCTATTGACTGGTACAAAAACCG
TATTAACGGTAAACAAGAGGTTATGATCGGTTACTCAGATTCAGGCAAAGATGCAGGACGTCTCTCAGCTGCTTGGGAGC
TATACAAAGCTCAAGAAGAGCTTGTGAAGGTTGCTAAGGAATATGGAGTGAAGCTGACAATGTTCCATGGCCGTGGTGGC
ACAGTCGGAAGAGGAGGTGGTCCCACTCATCTTGCTATATTGTCTCAGCCGCCGGATACAGTTAATGGCTCTCTTCGAGT
CACAGTTCAGGGTGAAGTCATTGAGCAATCATTTGGAGAGGAACATTTATGCTTTAGAACACTTCAGCGTTTCACAGCTG
CAACTTTAGAGCACGGAATGAACCCTCCAATTTCACCAAAACCTGAATGGCGTGCTTTGCTGGATGAAATGGCGGTTGTT
GCAACTGAGGAATACCGATCTGTTGTTTTCCAAGAACCTCGATTTGTCGAGTACTTCCGCCTGGCTACTCCGGAGCTGGA
GTATGGACGTATGAACATTGGAAGTAGACCTTCAAAGCGGAAACCAAGCGGTGGGATTGAATCTCTCCGTGCAATCCCAT
GGATTTTTGCATGGACGCAAACAAGATTTCATCTTCCCGTATGGTTAGGTTTCGGAGCAGCTTTTAGGTTTGCGATTAAG
AAAGATGTGCGAAACCTCCACATGCTGCAAGATATGTACAAGAACTGGCCATTTTTCCGAGTCACCATTGATCTAATTGA
AATGGTGTTCGCCAAGGGAGACCCCGGGATTGCTGCTTTGTACGACAAACTTCTTGTCTCAGAAGATTTATGGGCTTTTG
GAGAGAAACTCAGAGCCAACTTTGAAGAAACCAAGAACCTCGTCCTCCAGACTGCTGGACATAGAGATCTTCTTGAAGGA
GACCCTTACTTGAAACAGAGACTGAGGCTGCGTGACTCTTACATTACGACCCTCAACGTTTGCCAAGCGTACACATTGAA
GAGGATCCGTGATCCAAACTACAATGTGACCCTGCGACCACACATTTCCAAAGAGATCATGCAATCAAGCAAGTCAGCAC
AAGAGCTCGTCAAGCTTAACCCAACGAGTGAATACGCGCCAGGACTTGAGGACACACTCATCTTAACCATGAAGGGTATC
GCCGCAGGATTGCAAAACACCGGTTAA