Details for Capsella Locus Carubv10012895m

Position : scaf_3 ( 5`- 2833500 .. 2839298 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012895m

Protein [Map View]
MKLNQKLKKPCSPTKLVLQEIIGLTAKNANGLASATCSSKCVYLAGCVVVVYDVDSCTQSHLVVSHRMPKPLSCVAVSQN
GRFVAAGEKTRSSKVGSVSFHGKPTDNFFQKGNSFVSVISANTGSDEQTEEVFSIYALTDAALGTFRYKPFKLFFSFHNK
NFFHWLAMNCQVEKCFALSASSRLIACACSKGTVQLFMPETLDYAGKLHFSDAKSSNTENQSHSAELKTVESPPVIFPDA
VACQFSTTDKLIVIYGDRSLYVWDVNDVNKPTRCSMMVSHSAGIWDIKNLSCGNMHSPTAACVARGCSEGVSFATCSEDG
TIRLWDLAFQVDPLEASASSNPSESSTQGIMHLASAGIFERDLVETCGSRFGFRALAVSEDGKYLAAGDCGGNLHIYDLQ
ESEYTCFTDAHDTEIQSLSFSFPGVKEVNSVNTSSSGFLLASGGKGRAIHIYDVKRNFDPVGNVCSSAAVTSVKFACNGQ
KIITSGGDRLQLFDVVRKASSVRLSPSRSQTLSHGTISDMAVDRTTRLVVTVGQDKKINIFDLESGKHVRSFKQERDHGD
PVKVILDPSCNYMVCSYSNRTICFVDFDTGELVAQATGHGEPVTGVIFLPDCKHIISVASDGCIFVWKLPLRMATRIIRA
VNENGRLTVVQLEKFKQIAVDLEEDNPKDALCSANYKPAEENADLQLRSPWTSSFKFSVSRLPKWAQAKVETSDIATNCE
DSISNQKHEDKSLENTVDSAEGYSYVNLECQTPKQGSKTENSSLGSLSKSSSETETSVIQRDAPSHMKEKTRWNTIYNVC
LDLLNSPNIQASFIKKQKPVEQGDMFKQFDNSLSMIDEVEAKKSSQQRRYSSQFFLRRDYIGGTKQFMRTPSQKSGNKTL
KSIQEHLPLDTDKTSSEVFHDTLADDSLQEMITSCRQALYGLNSAAAVFVQSLSELSTASPRDQISGELREQLFGEAALM
IPEMSHKVNEVVAKIMLEHKNRTSDRIVSN*

DNA
ATGAAGCTGAATCAGAAATTAAAGAAGCCTTGTTCACCCACGAAGCTGGTTCTGCAAGAGATCATCGGTTTGACTGCAAA
GAACGCCAATGGATTGGCCTCGGCTACTTGCAGCTCGAAATGTGTTTACTTGGCGGGATGCGTTGTGGTGGTCTACGATG
TAGATTCGTGCACTCAGTCTCATCTTGTTGTATCTCATCGTATGCCTAAGCCTTTAAGTTGTGTTGCTGTGTCCCAGAAT
GGGCGGTTCGTAGCTGCTGGCGAGAAGACACGTTCAAGTAAAGTTGGATCTGTGTCATTTCATGGAAAGCCAACTGATAA
TTTTTTTCAAAAAGGAAACTCCTTTGTATCAGTGATATCAGCCAATACTGGGAGTGACGAACAAACTGAAGAAGTTTTTT
CAATATACGCTCTCACAGATGCAGCTTTGGGAACATTCAGATACAAACCTTTCAAGCTTTTCTTTTCTTTTCATAACAAG
AACTTCTTTCATTGGCTTGCAATGAACTGTCAGGTTGAAAAATGTTTTGCTCTTTCTGCATCCAGTCGGTTGATAGCATG
CGCTTGCAGCAAGGGAACGGTCCAGCTATTTATGCCTGAAACTCTAGATTATGCTGGCAAATTACATTTTTCAGATGCTA
AAAGCAGCAACACTGAAAATCAGTCTCATTCAGCAGAACTCAAAACTGTAGAATCTCCGCCTGTTATCTTCCCGGATGCA
GTTGCTTGTCAGTTTTCTACCACAGATAAGCTCATTGTCATCTATGGGGATCGTAGTCTCTATGTTTGGGATGTAAATGA
TGTGAACAAGCCTACTAGGTGCTCGATGATGGTGTCACATTCTGCTGGAATTTGGGATATTAAAAATCTCTCTTGTGGAA
ATATGCACAGTCCAACAGCTGCATGTGTAGCTAGGGGATGCAGTGAAGGGGTTTCCTTTGCTACATGTTCTGAAGATGGA
ACCATCAGATTGTGGGATCTCGCTTTCCAAGTGGACCCATTAGAAGCCAGTGCAAGCAGCAATCCCTCAGAATCTTCAAC
ACAAGGGATTATGCATTTAGCTAGCGCTGGAATTTTTGAACGTGATCTCGTGGAGACATGTGGTAGCCGATTTGGTTTCC
GAGCACTGGCAGTAAGTGAAGATGGAAAGTACTTAGCAGCTGGTGACTGTGGAGGGAACCTTCATATATATGATCTACAA
GAATCAGAGTATACATGCTTTACGGATGCTCATGATACAGAAATTCAGTCATTGAGCTTCAGCTTTCCTGGAGTGAAAGA
AGTTAATTCTGTAAATACTTCAAGCAGCGGTTTCTTGCTTGCTTCTGGTGGAAAGGGCCGAGCGATCCACATTTATGATG
TCAAAAGGAACTTTGATCCTGTTGGGAATGTTTGTAGTTCAGCTGCTGTAACTTCTGTGAAATTCGCATGTAATGGCCAG
AAAATCATAACTTCTGGTGGAGATAGGTTACAGCTGTTTGACGTTGTCAGAAAAGCAAGTAGTGTGCGTCTTTCACCTTC
TCGTTCTCAAACTCTCTCTCACGGAACCATCTCTGATATGGCTGTAGATCGAACAACAAGACTTGTTGTCACTGTGGGAC
AGGATAAGAAGATAAACATATTTGATTTAGAAAGTGGAAAGCATGTCAGATCATTTAAGCAAGAACGAGACCATGGAGAT
CCCGTAAAGGTCATTTTGGACCCAAGTTGCAACTACATGGTGTGCTCTTACTCTAACAGGACAATCTGCTTTGTGGACTT
TGACACTGGAGAGCTGGTTGCTCAGGCCACAGGACATGGTGAACCTGTGACTGGTGTTATCTTCCTACCTGATTGCAAAC
ATATCATTTCAGTTGCAAGTGACGGCTGTATATTTGTCTGGAAACTTCCTTTGCGAATGGCTACTCGTATTATACGGGCA
GTAAATGAAAATGGCAGGTTAACTGTGGTCCAACTCGAAAAGTTCAAGCAAATTGCAGTTGATTTGGAGGAAGACAATCC
AAAAGATGCATTATGTTCTGCAAACTATAAGCCAGCAGAAGAGAACGCAGATCTGCAGCTACGCTCCCCATGGACATCCT
CATTTAAGTTCAGCGTTTCTCGACTGCCTAAGTGGGCTCAAGCTAAAGTGGAAACATCTGATATTGCTACCAATTGTGAG
GATTCCATTTCAAACCAGAAACATGAAGATAAAAGTCTGGAAAATACTGTTGACAGTGCTGAAGGGTACTCGTATGTGAA
TCTTGAATGCCAAACTCCCAAGCAAGGTTCAAAAACCGAAAATTCAAGCCTTGGAAGCCTGTCCAAAAGCTCCAGCGAAA
CTGAAACTTCAGTGATTCAAAGAGATGCTCCTAGCCACATGAAAGAAAAAACCCGTTGGAACACTATCTACAACGTGTGT
TTGGATCTTCTAAATTCTCCAAACATCCAAGCATCTTTCATTAAAAAACAGAAACCTGTCGAGCAGGGGGACATGTTCAA
GCAGTTTGATAACAGTTTGTCAATGATCGACGAGGTTGAGGCCAAAAAATCATCGCAGCAAAGAAGATATTCTTCACAGT
TTTTCCTTAGAAGAGACTACATTGGCGGAACCAAACAGTTTATGCGTACGCCCTCCCAGAAATCAGGGAACAAGACTTTG
AAGTCAATCCAAGAACATCTTCCCCTAGATACGGACAAGACCTCTTCAGAAGTATTCCATGATACACTTGCAGACGATTC
ACTACAAGAAATGATAACAAGCTGCCGTCAAGCACTATACGGGTTAAACTCTGCTGCCGCAGTATTCGTCCAGTCACTGT
CGGAATTGTCTACAGCTTCTCCTCGAGATCAAATCTCAGGTGAACTGAGAGAACAGTTGTTTGGTGAAGCAGCTTTGATG
ATCCCAGAAATGTCTCATAAAGTCAATGAAGTTGTAGCCAAGATAATGCTTGAGCACAAAAATAGAACAAGTGACAGAAT
CGTCTCCAATTAG