Details for Capsella Locus Carubv10012881m

Position : scaf_3 ( 5`- 5998161 .. 6006381 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012881m

Protein [Map View]
MFFSGDPSTRKRVDLGGRSTKERDARKLLEQTRMERNRRLLQKQQNSAALKIQKFFRGRRSMAIERAKVRHDFCETYGSH
CQNVDRHCFEPGSSFLRQLLFFFKAQNSEDFVILVETCRLLHSLVSSSGGIVSLFSGLDYSTEHNLVDFRVKKLAFTCIE
AIHQNRNRLKDQLLVTPEEASISTTILMEAMALLLDPKLPWVCKIISYLQKRNIFKLVRELVTTAKESPGGQTMTGSILS
LERVLIMIVPHIGSEPCSCPVIDPRWSFSSMILTIPFLWKLFPNLKVVFASPSLSQHYIHQMAFCIQKGTCVLPLETSPE
FPGYACLLGNTLDTANMVLSLPECSLDMAIDIASVATFLLETLPPVKSSERESRQSSSDEDDMLIDDVPELVLNKALEQH
ITNAIDSRFLLQLTNVLFHQVLLGMQSYDEDKEALAIGTACSFLYAAFNTLPLERIMTILAYRTELVAVLWNYMKRCHEN
QKWSSMPKLLAYLPGDVPGWLLPLVVFCPVYKHMLMIVDNEEFYEREKPLSLQDIRLLIIILKQALWQLLWVNPLTQSNT
GKSVSNDLSKKNPVELIQNRVGVVVSELLSQLQDWNNRQEFTSSTDFQADTVNEYFISQAIIEGTRANYILMQAPFLIPF
TSRVKIFTTQLATARQSHGSQGIFARNRFRIRRDHILEDAYNQMSALSEDDLRGSIRVTFVNELGVEEAGIDGGGIFKDF
MEKITRAAFDVQYGLFKETADHMLYPNPGSGMIHEQHLQFFHFLGSLLAKAMFEGILVDIPFATFFLSKLKQKYNYLNDL
PSLDPELYRHLIFLKRFKGDISELELYFVILNNEYGERTEEELLPGGNDMRVTNENVITFIHLVSNHRLNFQIRQQSSHF
LRGFQQLIPKEWIDMFNEHELQVLISGSVDSLDIDDLRNNTNFAGGYHADHYVIEMFWEVMKSFSTENQKKFLKFVTGCS
RGPLLGFKYLEPAFCIQRAAGSASNESVDRLPTSATCMNLLKLPPYQSKELLETKLMYAISAEAGFDLS*

DNA
ATGTTCTTCTCCGGCGATCCTTCGACTCGGAAGCGAGTTGATTTAGGTGGCCGGAGCACCAAGGAGAGAGATGCTCGGAA
GCTTCTGGAGCAGACTAGAATGGAGCGTAATCGTCGGTTGCTACAGAAGCAGCAGAACTCTGCTGCCCTCAAAATTCAGA
AATTCTTTAGAGGTAGAAGATCAATGGCCATTGAACGCGCGAAGGTGCGACATGATTTTTGTGAAACCTATGGGAGTCAT
TGCCAGAATGTCGATAGACATTGCTTTGAGCCAGGTTCAAGTTTCCTCCGGCAGCTTCTGTTTTTTTTCAAGGCACAGAA
CTCGGAAGATTTTGTGATACTTGTGGAGACTTGTCGTCTTCTGCACAGTCTCGTTTCCAGCAGTGGTGGCATTGTCAGCC
TTTTTTCTGGTTTGGACTATTCCACTGAGCATAATTTGGTGGATTTTAGAGTAAAGAAACTTGCATTTACCTGCATCGAG
GCTATTCATCAGAATAGGAACCGTTTAAAGGATCAGCTCTTAGTTACTCCTGAAGAAGCTAGCATTTCAACAACTATCTT
GATGGAGGCAATGGCGTTGTTGCTAGATCCTAAACTGCCTTGGGTTTGCAAAATAATTAGTTATCTACAAAAGAGAAACA
TATTCAAACTGGTCCGCGAATTGGTCACAACGGCTAAGGAAAGCCCCGGAGGTCAGACTATGACCGGCAGCATCCTTTCA
CTAGAAAGAGTATTGATAATGATAGTACCACATATTGGCAGCGAGCCATGTTCCTGCCCTGTTATTGATCCACGTTGGAG
TTTCTCATCTATGATCCTCACAATACCTTTCTTATGGAAGCTCTTCCCAAACTTGAAAGTGGTCTTTGCCAGCCCAAGTC
TAAGTCAACATTACATTCACCAGATGGCTTTCTGTATACAAAAGGGTACATGTGTTCTCCCACTGGAAACAAGCCCGGAA
TTCCCTGGTTATGCTTGTCTGCTTGGTAATACGTTGGACACTGCAAATATGGTGTTGTCACTACCTGAATGTTCATTGGA
CATGGCAATTGACATTGCATCAGTTGCAACTTTCTTATTGGAGACGCTTCCTCCTGTGAAATCATCAGAAAGAGAAAGCA
GACAAAGCTCTTCTGATGAGGATGATATGTTGATTGACGATGTACCAGAATTAGTCTTGAATAAGGCTCTGGAGCAGCAT
ATAACCAATGCTATAGACTCACGTTTTCTTCTGCAGTTAACAAATGTTTTGTTCCATCAAGTTTTGCTTGGTATGCAGTC
ATATGACGAAGATAAAGAAGCATTAGCTATTGGCACAGCCTGTTCTTTTCTGTATGCAGCATTCAACACTCTCCCTCTTG
AACGGATCATGACAATTTTGGCTTATAGAACCGAGCTTGTAGCTGTGTTGTGGAATTATATGAAACGATGCCATGAGAAT
CAGAAGTGGTCATCTATGCCTAAACTCCTAGCCTACCTTCCAGGGGATGTTCCGGGTTGGCTATTACCTCTGGTTGTTTT
TTGTCCTGTTTATAAGCATATGCTTATGATAGTTGACAATGAGGAGTTTTATGAGAGAGAAAAGCCATTATCGCTACAAG
ATATCAGGTTGCTGATCATTATTCTTAAGCAGGCTTTATGGCAGTTACTATGGGTGAATCCACTTACGCAATCTAACACT
GGAAAATCTGTATCCAACGACCTCTCTAAGAAGAACCCTGTTGAGTTGATTCAGAACAGGGTTGGGGTTGTAGTCTCTGA
GCTTCTTTCACAGTTGCAAGATTGGAACAACCGGCAAGAATTCACTTCCTCGACTGACTTCCAAGCTGATACAGTCAATG
AATATTTCATCTCTCAGGCCATAATAGAAGGTACGAGAGCCAACTACATACTGATGCAAGCTCCTTTCTTGATTCCGTTT
ACAAGCAGAGTCAAAATATTCACAACACAATTAGCAACAGCAAGGCAGAGTCATGGATCTCAAGGAATTTTTGCTCGAAA
TCGGTTCAGAATACGAAGAGATCATATCTTGGAAGATGCTTACAATCAAATGAGTGCATTGTCAGAGGATGATCTCCGGG
GGTCGATTCGGGTGACATTTGTCAACGAACTCGGAGTTGAGGAAGCTGGTATTGATGGTGGTGGAATTTTTAAAGACTTC
ATGGAGAAAATCACCCGAGCAGCCTTTGATGTGCAATACGGGTTGTTTAAGGAGACCGCTGATCACATGCTTTATCCTAA
TCCTGGATCAGGAATGATACATGAACAACATCTCCAGTTCTTTCATTTTCTCGGCAGTCTTCTCGCAAAAGCTATGTTTG
AAGGGATTCTTGTTGATATACCATTTGCAACGTTTTTCCTTAGCAAATTGAAACAAAAGTACAACTATCTCAACGATTTG
CCTTCCCTGGATCCTGAGTTGTATAGGCACCTCATATTTCTGAAGCGTTTTAAGGGTGATATCTCAGAGTTGGAGCTTTA
CTTTGTTATTTTGAATAATGAATATGGAGAGAGGACAGAGGAAGAGTTACTTCCAGGGGGGAATGATATGCGAGTTACAA
ATGAGAATGTTATAACTTTCATTCATCTGGTTTCCAATCATCGGTTAAATTTTCAGATACGCCAGCAGAGTTCTCATTTC
CTGAGGGGGTTTCAGCAACTCATCCCGAAAGAATGGATCGACATGTTCAATGAACATGAACTTCAGGTTCTCATATCTGG
TTCAGTTGATAGTTTGGATATTGACGACCTGCGAAATAACACCAATTTTGCTGGAGGCTACCACGCGGACCATTATGTGA
TCGAGATGTTCTGGGAAGTCATGAAAAGCTTCTCAACTGAAAACCAGAAGAAGTTCTTAAAGTTTGTGACGGGCTGTTCA
CGAGGGCCACTGCTCGGTTTCAAATACTTGGAACCTGCATTCTGCATACAGAGGGCTGCCGGTAGTGCGAGTAATGAATC
AGTTGATAGACTACCGACATCAGCCACTTGTATGAACCTTCTTAAGCTTCCGCCTTATCAAAGCAAAGAGCTACTTGAGA
CCAAGTTGATGTACGCCATAAGTGCAGAAGCGGGTTTTGATCTGAGCTGA