Details for Capsella Locus Carubv10012880m

Position : scaf_3 ( 5`- 7779429 .. 7784152 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012880m

Protein [Map View]
MAKANNNFSADQETQPIDDDSNPSSPSASGEDKDSLFGDCDTQPFEDSAWIDDQYMETQVVDIGCDNEEFLLCGETQAVD
LVFETQEEPFVEGTQLLEASDGLAATQVLDHFDDQVVADSDDDVTAVLEDGSELSDDSDDSCSKAKTVLSSEENRQDGSG
KVKSTCALDAWSNEHGISGKKMARFASVRSAAFRASAVAARFAAPKIPNSDRSTLVNFHTSGQGDTHNSSLEYRVGEVGN
QQSLTSIFVEKKNDLQTGNRTARKLFQEDLPEENCHSVDYNVDLEDLSYIDSQEPGEASQASALKLVDKLINESRVEFGF
EVEADCGRRTEEKSKFVPIFKGPQELAKKLSYKSGAVGNCVFDWDDNREDEGGGDIYRRRKDEFFGIASKGREFSTLPRE
QKRELIHESHGGLGDVVDKRRTRSDSKLLQHSVTRSQKNIQAAKKNLAKELDDVREAVVLGNDAQVADETIDDLCSRDRS
KFVSETSCLTGKKLSPGEERGYSPGGVVTRQSRGTKRIQAMSKDELLKKRRKKASPNTEGSSKDDQLDKEGPSCWKSRKI
QTASRETEKNFVVGLDEVSKESNTKLFDRNEEVEAGPDTQMAAEVMNALYSGDGREIDPELNNLIGKKLSLKGGISSRGV
VTRKSKRIKGMQAVDNDVESLDTKTKKARSICAKSCEKNRDRYLKNDKVNPPDEVVVSTTEKRQGEFSNKHIMSKLPRQS
SRGDTEALNYPKRRRSARILQDQVNEAGRSTDPTFDTPVKSKMPSTNVSPICMGDEYLRLSCKDSVTSHTTREFRSLTLP
LAEPISETKSTRKRRDLGSVRVLFSQHLDEDVTKHQKKILARFDISEASSMKEATHFIADNFTRTRNMLEAIASGKPVVT
TQWLESIGQVNIYVDEDLYILRDIKKEKEFCFNMGVSLARARQFPLLQGRRVFITPNTKPGLNTITTLVKAVHGLPVERL
GRSILSKDKVPENLLVLSCEEDRTICIPFLERGAEVYSSELLLNGIVTQRLEYERYRLFTDHVRRTRSTIWIKDVKGKFQ
RRSG*

DNA
ATGGCTAAAGCAAATAATAACTTTTCAGCGGATCAAGAGACCCAGCCGATTGATGATGATTCTAATCCCTCTTCGCCTTC
TGCTTCTGGCGAAGATAAAGATAGTTTGTTTGGGGACTGTGACACACAACCTTTTGAGGACAGTGCTTGGATTGATGATC
AATATATGGAGACTCAGGTCGTGGATATTGGATGTGATAATGAAGAGTTTCTACTTTGTGGTGAAACTCAAGCAGTTGAT
TTGGTATTTGAAACCCAAGAAGAACCTTTTGTTGAAGGGACACAGTTACTCGAAGCTTCTGATGGTTTGGCGGCTACACA
GGTTTTGGATCATTTTGATGATCAAGTTGTTGCGGATAGTGATGATGATGTTACTGCTGTCTTGGAAGATGGTAGTGAGC
TCTCTGACGACAGTGATGACTCGTGTAGTAAAGCCAAAACTGTTTTATCTAGTGAAGAGAACAGACAGGATGGTAGTGGA
AAGGTTAAATCAACATGTGCCCTTGATGCTTGGTCAAATGAACATGGGATTTCTGGCAAAAAGATGGCTAGGTTTGCTTC
AGTTCGTTCTGCAGCTTTCCGTGCATCTGCTGTGGCAGCTCGTTTTGCAGCCCCAAAGATACCCAACAGTGACCGTTCTA
CTTTAGTCAACTTTCATACTTCTGGACAAGGAGACACACATAATTCTTCTCTGGAATATAGAGTTGGAGAAGTAGGGAAT
CAGCAATCTCTTACCAGTATATTTGTTGAAAAGAAAAATGACTTACAAACAGGAAACAGAACAGCGAGGAAGCTTTTCCA
GGAGGATTTGCCTGAAGAAAATTGCCATTCTGTTGATTACAATGTCGATCTGGAGGATTTGAGTTATATTGACTCTCAAG
AACCTGGTGAGGCATCCCAGGCCAGTGCTCTTAAGTTGGTTGATAAGCTCATTAATGAGTCCCGTGTAGAGTTTGGTTTT
GAAGTTGAAGCAGACTGTGGAAGGAGAACGGAAGAAAAGTCAAAATTTGTCCCGATTTTTAAAGGCCCACAAGAATTAGC
AAAGAAATTAAGTTACAAAAGCGGAGCTGTTGGTAACTGTGTTTTCGACTGGGATGATAATCGTGAGGATGAAGGAGGTG
GTGATATCTACCGTAGAAGAAAAGATGAATTCTTTGGCATTGCAAGTAAAGGACGGGAATTTTCTACCTTGCCTAGAGAA
CAGAAAAGAGAATTGATACATGAAAGTCATGGAGGACTTGGGGATGTAGTGGATAAAAGAAGGACTCGTTCTGATTCCAA
ACTATTGCAGCATAGTGTGACCAGGAGCCAAAAGAATATCCAGGCTGCTAAAAAGAATCTTGCCAAAGAGTTAGATGATG
TTCGTGAAGCGGTTGTTTTGGGGAATGATGCACAAGTTGCTGATGAAACAATTGATGATCTGTGCTCTAGAGACCGTAGC
AAGTTTGTTTCTGAGACAAGTTGTCTTACGGGAAAGAAACTGTCACCAGGAGAAGAAAGAGGATATTCTCCCGGTGGAGT
CGTTACTAGACAATCCAGGGGAACTAAGAGGATTCAGGCTATGAGTAAAGATGAATTGTTGAAAAAAAGAAGGAAGAAGG
CTAGTCCGAATACTGAAGGGTCTTCAAAGGATGACCAGCTTGATAAAGAAGGTCCGTCCTGCTGGAAAAGTAGGAAGATC
CAGACTGCTTCACGAGAAACTGAAAAGAATTTTGTTGTTGGTTTAGATGAAGTTTCCAAGGAAAGTAATACAAAATTGTT
TGATAGGAATGAAGAGGTAGAAGCAGGGCCAGATACACAAATGGCTGCTGAAGTGATGAATGCTCTGTACTCTGGGGACG
GCAGGGAGATTGATCCTGAGCTAAACAATCTAATAGGTAAGAAGTTGTCACTGAAAGGAGGCATTTCTAGTCGTGGAGTC
GTTACCAGAAAATCCAAGAGGATTAAGGGAATGCAGGCTGTGGATAATGATGTTGAATCACTTGATACAAAAACAAAGAA
GGCTAGATCAATTTGTGCCAAATCTTGCGAGAAGAATAGGGATAGGTATTTAAAAAATGACAAAGTTAATCCGCCTGATG
AAGTTGTTGTGTCAACTACAGAGAAGAGGCAAGGAGAATTTTCAAACAAGCATATTATGTCTAAGTTACCTAGGCAATCA
AGTAGAGGTGACACTGAGGCGTTGAATTATCCCAAGAGGAGAAGATCAGCTCGTATTTTGCAAGATCAGGTTAATGAGGC
AGGGAGGAGTACAGATCCCACTTTTGATACTCCAGTTAAGTCTAAGATGCCTTCAACGAATGTGTCGCCTATATGCATGG
GTGACGAATATCTTAGACTTTCTTGCAAGGATTCAGTTACATCACACACTACAAGGGAATTTCGTAGCTTAACCTTACCA
TTAGCGGAACCTATCTCCGAGACAAAGAGTACTAGAAAGAGAAGAGATTTGGGTAGTGTACGTGTCTTGTTCAGCCAGCA
TCTTGATGAAGATGTGACCAAGCATCAGAAGAAGATTTTGGCAAGGTTTGATATCTCGGAAGCTTCCTCCATGAAAGAGG
CAACACACTTCATTGCTGATAACTTTACGCGCACAAGGAACATGCTAGAAGCAATCGCTTCAGGCAAGCCAGTGGTCACA
ACACAATGGCTTGAAAGCATCGGCCAAGTAAACATATATGTTGACGAGGATCTGTATATTCTCAGAGATATAAAGAAGGA
GAAGGAATTCTGTTTCAACATGGGAGTTTCTTTGGCTCGTGCACGCCAGTTTCCGCTACTACAGGGGAGAAGAGTTTTTA
TCACCCCAAATACAAAGCCTGGTCTAAACACAATCACGACTTTGGTTAAGGCAGTTCATGGACTGCCTGTAGAAAGACTC
GGAAGATCTATCCTAAGCAAAGATAAGGTCCCAGAAAATCTTTTGGTCCTATCATGTGAAGAGGATCGAACTATCTGCAT
ACCATTCCTAGAGAGAGGGGCTGAGGTATATAGCTCGGAGTTACTTTTAAATGGGATAGTTACTCAAAGGCTTGAGTATG
AAAGGTACCGTCTCTTCACAGACCATGTGAGGAGAACGCGGTCAACAATATGGATCAAAGACGTAAAAGGCAAGTTCCAA
CGCCGTAGCGGGTAA