Details for Capsella Locus Carubv10012879m

Position : scaf_3 ( 5`- 1570886 .. 1579439 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012879m

Protein [Map View]
MAPVRKSRSVNKRFTNESSPGKDAGSSRKNKQRKKKLSDKLGPQWTRVELERFYDAYRKHGHEWKKVAAAVRNSRSIDMV
EALFNMNRAYLSLPEGTASVAGLIAMMTDHYSVMEGSGSEGEGHDASEVPRKQQKRKRAKPQLSDSREEVDIKHGVASTD
GCLTFLKQARANGTQRHATGKRTPRVPVQNSYMRDDRECFTPPNKRARKQFDANDDVAHFLALALTDASRRGGSSKVSES
PNRRTELNASSPIKSWGNMSRTRKSQSKHCDNSVFEEWVGSSQERKLESDKDTALLGDMEGVSELEAARKGKRFYKKRVK
VEVEEAEGNVSDDNGEACSATEGLRIKSQRRKAAMEASRGKYLSHSAKKRDNKLTSGDEFDALQALAELSASMIPATLME
SESSARLKEERTEYNMDERSSTPEATPSSSNGEKANAEPDDDSLLHAISSGENANKRKPKPSRQASTDCDVVPTGKLQPQ
TSGSLRRKRIPKVLGDEAPADVSQKKITNKKELSQDENNMKSLVRTKRVGQGPAQSKQLKTAKTLDEFTTTSDKNRPEMD
VVASTKQVSDSCPASVSQKPPNKRKKSLKKSLQERAKSSETIHKASRSSRSLSEQELLLKDKMSTALSYPLARRRCIFEW
FYSAIDHPWFAKMEFVDYLNHVGLGHIPRLTRLEWSVIKSSLGRPRRFSERFLQEEREKLKQYRESVRKHYTELRTGARE
GLPTDLARPLSVGNRVIAIHPKTREIHDGKILTVDHNKCNVLFDDLGVELVMDIDCMPLNPLEYMPEGLRRQIDKCLSMK
KEAQLSGNSNIGVSVIFPPCGLENVSFSMNPPLNQGDIIAPILHGKVSTNTSSPQQTNHSYITTYNKAREAEIQRALALQ
HASDEKEMEPEMLEIVKGSKTRAQAMVDAAIKAASSVKEGEDANKMIQEALDLIGKHQPLRGFRFKHHEHVNGNIEHHQN
PSPSDTSETMANNDFNSQDGSDLITSCVATWLMIQMCTERQYPPADVAQLIDAAITSLQPRCPQNLPIYREIQTCMGQIK
TQILALVPT*

DNA
ATGGCGCCGGTTCGAAAGTCGAGGAGTGTGAACAAGCGTTTCACGAATGAAAGTTCCCCAGGAAAAGATGCTGGGAGCTC
CAGAAAAAATAAGCAGCGTAAGAAGAAATTGTCTGACAAGCTGGGACCTCAGTGGACCAGAGTAGAACTTGAGCGTTTCT
ATGACGCTTATCGGAAGCACGGGCATGAGTGGAAAAAGGTTGCTGCTGCGGTTCGGAATAGCAGGTCAATTGACATGGTT
GAAGCTCTATTTAATATGAATCGGGCATATTTATCTCTTCCCGAGGGAACTGCCTCTGTAGCTGGCCTGATTGCAATGAT
GACAGATCACTACAGTGTCATGGAAGGGAGTGGCAGTGAAGGAGAAGGCCATGATGCTTCAGAAGTACCAAGGAAACAAC
AAAAGCGCAAACGTGCTAAACCTCAGCTTAGCGATTCTCGGGAGGAAGTTGATATAAAACATGGAGTTGCTTCAACAGAT
GGATGCCTCACGTTTTTGAAGCAAGCACGAGCTAATGGAACTCAGCGACATGCCACTGGAAAACGTACACCACGGGTTCC
TGTACAAAATTCATATATGAGGGATGATAGAGAATGCTTCACTCCACCAAATAAAAGAGCTAGGAAGCAATTCGATGCCA
ATGATGATGTAGCACATTTTTTAGCGTTAGCATTAACAGATGCATCGAGAAGAGGTGGGTCTTCAAAAGTTTCTGAATCA
CCAAATAGAAGAACAGAGCTTAACGCTAGCTCACCAATAAAAAGCTGGGGGAATATGTCGCGAACTAGAAAATCTCAATC
AAAGCACTGCGACAACTCCGTTTTCGAGGAGTGGGTGGGAAGTAGCCAAGAAAGGAAGCTTGAATCTGATAAAGATACTG
CCTTGTTGGGGGATATGGAAGGGGTTAGCGAATTGGAAGCTGCACGGAAGGGGAAAAGATTCTACAAGAAAAGGGTGAAA
GTCGAAGTTGAAGAAGCAGAAGGTAATGTTTCTGATGACAATGGAGAAGCATGCAGTGCCACAGAGGGACTCAGAATTAA
ATCACAGAGACGAAAGGCAGCTATGGAAGCCTCAAGAGGGAAATATTTATCACACAGTGCAAAGAAAAGAGATAACAAAC
TTACTTCCGGAGATGAATTTGATGCTCTGCAAGCATTGGCCGAATTGTCAGCTTCAATGATTCCAGCGACTTTGATGGAA
TCAGAATCATCTGCTCGGTTGAAGGAAGAAAGAACAGAATACAACATGGACGAGAGATCTAGTACACCAGAAGCTACGCC
CTCTAGCAGTAATGGGGAAAAAGCAAATGCAGAACCAGATGATGATAGTCTCCTTCATGCAATCTCTTCTGGTGAGAATG
CTAACAAGAGAAAGCCAAAACCTTCAAGGCAGGCATCCACTGATTGTGATGTTGTACCCACAGGGAAGCTACAACCCCAA
ACTAGTGGCAGTTTAAGAAGAAAACGCATTCCAAAGGTTCTGGGGGATGAAGCTCCAGCCGATGTTAGTCAGAAAAAAAT
CACAAACAAGAAGGAATTGTCTCAGGATGAGAATAATATGAAGTCTTTGGTTAGAACAAAACGTGTTGGTCAAGGTCCAG
CTCAGTCAAAACAGTTGAAAACTGCTAAGACGTTGGACGAATTTACTACAACAAGCGATAAGAACAGACCCGAGATGGAT
GTAGTAGCGTCAACTAAACAAGTTTCTGATTCTTGTCCAGCCAGTGTATCTCAGAAACCTCCAAACAAGCGTAAAAAGAG
TCTGAAGAAAAGCTTACAAGAAAGGGCTAAATCTTCTGAAACCATTCATAAAGCTTCACGTAGTTCCAGATCTCTTTCAG
AACAGGAGTTGTTATTAAAGGATAAGATGTCTACTGCTCTGTCGTATCCCTTGGCACGTAGAAGGTGCATATTTGAATGG
TTCTATAGTGCTATCGACCATCCCTGGTTTGCAAAGATGGAGTTTGTCGATTACCTAAATCATGTGGGACTTGGTCACAT
TCCAAGACTTACTCGTCTTGAATGGAGTGTCATTAAAAGTTCTCTTGGTAGACCCAGAAGATTCTCTGAGAGATTTTTAC
AGGAAGAGCGGGAGAAACTTAAACAGTACCGCGAATCGGTGCGAAAGCATTATACAGAGCTTCGAACAGGTGCTAGGGAA
GGGCTTCCTACAGATTTGGCTCGGCCGTTATCAGTTGGGAACAGAGTCATTGCCATCCATCCCAAAACACGAGAGATTCA
TGATGGGAAAATTCTCACTGTTGACCATAACAAATGCAATGTTCTGTTCGATGACTTGGGCGTCGAGTTGGTTATGGACA
TTGATTGCATGCCTTTAAATCCTCTTGAATACATGCCAGAGGGTCTAAGGAGGCAAATTGATAAGTGCTTATCTATGAAG
AAAGAAGCACAGTTAAGCGGGAATTCAAACATTGGTGTGTCTGTGATATTCCCTCCTTGCGGACTTGAAAACGTCAGCTT
TTCCATGAACCCTCCTCTGAATCAGGGTGATATAATTGCTCCCATTCTGCATGGTAAAGTATCAACCAACACTAGTAGTC
CACAGCAGACTAATCATTCATATATCACAACTTATAACAAAGCAAGAGAAGCTGAGATTCAACGAGCACTTGCACTACAG
CATGCTTCAGATGAAAAGGAAATGGAGCCAGAGATGCTGGAAATTGTTAAGGGTTCAAAGACAAGAGCGCAAGCAATGGT
GGATGCAGCTATAAAGGCTGCATCATCTGTGAAGGAAGGAGAAGATGCAAACAAAATGATCCAAGAAGCCTTAGACTTGA
TTGGCAAACATCAGCCATTACGTGGCTTTAGGTTCAAACATCATGAACATGTAAATGGCAACATAGAGCACCATCAAAAC
CCATCTCCCTCGGACACATCAGAGACTATGGCTAACAACGATTTTAACTCACAAGATGGTTCAGACCTAATCACCTCCTG
TGTTGCCACTTGGCTCATGATTCAGATGTGCACGGAGAGACAGTATCCTCCAGCTGATGTGGCACAGCTTATAGACGCAG
CAATCACAAGCTTGCAGCCACGATGCCCCCAGAACCTACCGATCTATAGAGAAATCCAAACGTGCATGGGACAGATCAAG
ACTCAGATCCTGGCCCTTGTACCTACTTGA