Details for Capsella Locus Carubv10012877m

Position : scaf_3 ( 5`- 4979953 .. 4989261 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012877m

Protein [Map View]
MIVGEMVLSAFLQSLFQTLMSAPFKNFFKRRELSENVLERLNIALLTISAVLIDAEDKQITNSVVEKWVNELRDVVYHAE
DALDDIATEALRLNIGAESSSSNRLRQLRGRMSLGDFLDGSSEHLETRLEKVTMRLERLASQRNVLGLKELTAMTPKKRL
PTTSLVDESEVFGRADDKDEIMRYLIPENGNDSGLTVIAIVGTGGVGKTTVSQLLYNDQRVQSHFGTRVWVHVSEEFDVF
KITKKVYESVTSRPCEFTDLDVLQVKLKERLIGLPFLLVLDDLWNENFVDWDLLRQPFIPAAQGSRILVTTRSQRVASNM
CSVHVHNLKPLSDGDCWSLFIRTVFGNQDPCLDREIGDLAERIVHKCRGLPLAVKTLGGVLRFEGKVTEWERVLSSMIWD
LPADKSNLLQVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKEKVILLWMAEGFLQQTRSSKNLEELGDEYFSELESRSLF
QKTKTRYIMHDFINELSQFASGEFSSKFEDGYKLKVSERTRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLTNSSRSC
YLDTMVSANLLSMLTRVRVLSLSHYKIARLPPDFFRNLSHTRFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPT
DICNLINLRYLDLYGTKLRQMPRKFGRLKSLQTLTTFFASASDGARICDLGELHELHGKLKLVELQRVVDVADAAGANLY
SKKYLKEIDFVWRTGSTSLESNTNPHRTQNEAEVFEKLRPHSHIEKVTIERYKGRRFPKWLNDSSFSRIVFIRLRECQYC
SSLPSLGQLPGLKELYISGMAGLRRIGTEFYFSDLQLRDREQQPFRSLETLRFDNLPDWEEWLDVSVARGDLFPSLKKLY
IRRCPELTRIPTILPSLISLHIHQCGFLDFQPDHHEYNYGNLQTLSIKSSCDSLITFPLSRFENLADLEIDHCTSLHTLQ
LSNEHSYGLNALRNLRINDCQNLQRLPELNLLSQNLQVTISNCRYLRVPMEQHPQYLHPQFHLPRSNVSGSPRSHGSHRS
YDSRSPSRYD*

DNA
ATGATTGTAGGAGAGATGGTTCTTTCAGCTTTCTTACAATCTCTCTTTCAGACGCTGATGTCTGCACCTTTCAAGAACTT
CTTCAAGAGGCGGGAACTGAGTGAGAATGTACTAGAGAGGCTCAACATTGCGTTGTTGACAATAAGTGCGGTTCTGATAG
ATGCAGAGGATAAGCAGATTACAAACTCGGTGGTGGAAAAATGGGTCAACGAGCTGAGAGATGTTGTTTACCATGCTGAA
GATGCTCTTGATGATATTGCCACAGAAGCTCTGCGTCTCAACATAGGAGCTGAATCTTCTTCCTCCAACAGGCTGAGACA
GCTTCGTGGCAGAATGTCTTTGGGAGATTTTCTTGATGGGAGTAGTGAACATTTAGAGACCCGGCTTGAGAAGGTCACGA
TGAGGCTTGAGCGTTTAGCTTCACAAAGAAATGTCCTGGGTTTGAAAGAGCTTACTGCAATGACACCCAAAAAAAGGTTG
CCAACAACATCTCTTGTGGATGAATCTGAAGTGTTTGGTAGAGCTGATGATAAAGATGAAATCATGAGATATTTGATTCC
TGAAAATGGAAATGATAGCGGGTTAACCGTTATAGCTATTGTTGGCACTGGAGGGGTTGGCAAAACCACAGTTTCACAAC
TCCTATACAATGATCAACGTGTTCAGAGTCATTTTGGAACTAGAGTATGGGTTCATGTCTCGGAGGAGTTTGACGTTTTT
AAGATCACCAAAAAGGTTTATGAATCCGTTACTTCCCGGCCTTGCGAATTCACCGACCTGGATGTACTTCAAGTCAAATT
AAAGGAGAGGTTAATAGGTTTACCGTTTTTGCTTGTTTTAGATGATTTGTGGAATGAAAATTTTGTGGATTGGGATCTTC
TACGCCAACCTTTCATACCTGCTGCTCAAGGGAGCCGGATTCTTGTGACCACAAGAAGCCAACGTGTCGCATCCAATATG
TGTTCTGTCCATGTACACAACCTTAAGCCATTATCTGATGGAGATTGCTGGTCGTTGTTCATAAGAACTGTATTTGGTAA
CCAAGATCCGTGCCTAGATCGAGAAATTGGGGATCTTGCAGAAAGGATAGTGCATAAGTGCCGCGGCCTGCCTTTGGCTG
TGAAAACACTCGGTGGCGTTCTACGATTTGAAGGTAAAGTTACAGAATGGGAGAGAGTTTTGAGCAGCATGATTTGGGAT
CTTCCAGCTGATAAGAGCAACCTACTTCAAGTTTTACGAGTAAGCTATTACTACCTTCCAGCTCACTTGAAACGATGTTT
TGCTTATTGCTCGATATTTCCCAAAGGACATGCGTTTGAGAAGGAAAAGGTAATTCTTTTGTGGATGGCAGAAGGTTTCT
TGCAACAGACGAGAAGCAGTAAGAATCTAGAAGAGCTTGGGGATGAGTACTTTTCTGAATTAGAGTCAAGGTCGCTTTTT
CAAAAGACAAAGACGAGATATATTATGCATGACTTTATCAATGAGTTGTCTCAATTTGCTTCAGGAGAGTTCAGCTCAAA
ATTTGAAGATGGATACAAACTTAAGGTTTCAGAAAGGACCAGATATTTATCGTACCTGCGAGATAATTATGCTGAGCCTA
TGGAGTTTGAGGCTCTTCGCGAAGTCAAGTTTCTCAGAACTTTTCTACCACTCAGCCTCACAAATTCTTCTCGGTCATGC
TATTTAGATACAATGGTCAGCGCGAATTTACTTTCAATGCTTACTCGCGTGCGTGTTTTGTCTTTGTCACATTACAAGAT
CGCAAGGCTGCCGCCAGATTTTTTCAGGAATTTGAGTCATACTCGGTTTTTGGATCTCTCTCGCACTGAACTCGAGAAAC
TTCCAAAATCCCTTTGTTATATGTACAACCTCCAGACACTTCTTCTCTCCTACTGTTCCAGTCTGAAGGAGCTTCCTACA
GACATCTGCAACCTCATCAATCTGCGGTATCTTGATCTGTATGGAACAAAGCTAAGACAAATGCCACGAAAATTCGGTAG
ATTGAAGAGCCTTCAGACGCTTACAACCTTTTTTGCAAGTGCTAGTGACGGTGCAAGGATTTGTGACCTTGGAGAGCTTC
ATGAACTTCATGGAAAACTTAAATTAGTCGAGCTACAACGAGTTGTGGATGTCGCCGATGCTGCAGGAGCAAACTTATAT
AGCAAAAAATATCTGAAGGAGATAGATTTTGTTTGGAGAACTGGATCTACTAGCTTAGAGAGCAACACAAATCCTCACAG
GACGCAAAATGAAGCTGAGGTCTTTGAGAAGTTACGCCCGCATAGTCATATCGAGAAAGTCACCATTGAGAGATACAAAG
GAAGAAGGTTTCCAAAATGGTTGAATGATTCTTCGTTCTCTAGAATTGTGTTCATACGCCTCAGAGAGTGCCAATATTGT
TCCTCCTTGCCATCCCTTGGTCAATTACCAGGTCTCAAAGAACTTTACATTTCAGGAATGGCTGGGCTTAGACGGATAGG
TACTGAGTTCTACTTCAGCGATCTACAACTGCGCGATCGAGAACAACAGCCATTTAGATCGCTTGAAACATTGCGATTTG
ATAACTTGCCAGATTGGGAAGAGTGGTTAGATGTAAGTGTCGCAAGAGGAGACTTATTTCCTTCTCTCAAGAAACTTTAC
ATACGGAGATGCCCAGAGCTAACCCGGATACCGACCATACTTCCTTCTCTGATCTCTCTTCACATCCATCAATGTGGCTT
CTTAGATTTCCAGCCAGACCACCACGAATACAACTATGGGAACCTTCAAACGCTAAGCATAAAAAGCAGCTGTGACTCTC
TCATTACATTTCCTTTAAGCCGTTTCGAAAACCTCGCCGACCTTGAAATTGATCACTGCACATCTCTGCACACTCTTCAG
CTCTCAAATGAACATTCGTATGGTCTGAATGCTCTAAGAAACCTGAGAATCAATGACTGTCAGAATCTGCAGCGTCTTCC
AGAGCTAAACTTGCTGTCTCAAAACTTACAGGTAACGATCTCGAACTGCAGGTATCTCAGAGTGCCAATGGAACAACATC
CTCAATATCTTCATCCTCAGTTTCATCTTCCACGATCAAACGTTTCAGGTTCACCGAGGTCTCATGGTTCACACAGATCA
TATGATTCACGTTCACCTTCAAGATATGACTAA