Details for Capsella Locus Carubv10012876m

Position : scaf_3 ( 5`- 8738896 .. 8747422 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012876m

Protein [Map View]
MERSLLTQAAVSSSLSSKTQASSFFYFNGRSLPSLNPIGPSPSIRSFPLVRSNRKKSLVRMTVSGDSSESVEIGSSDMIF
QPILEHGVFRFDCSVEHKKAAFPSVSFKNSKDREKPIASRNVPAYIPTCACLQDQQVVTFEFSPGTSFYGTGEVSGQLER
TGKRVFTWNTDAWGYGSGTTSLYQSHPWVLVVLPNGETLGVLADTTRKCEIDLRKEASIRIIAPTLYPIITFGPFSSPTA
VLESLSHAIGTVFMPPKWALGYHQCRWSYMSDKRVAEIAQTFRDKKIPSDVIWMDIDYMDGFRCFTFDKERFPDPCALAK
DLHNNGFKAIWMLDPGIKQEEGYDVYDSGEKNDLWVSRADGKPFIGEVWPGPCAFPDYTNSKTRTWWANLVKEFVSNGVD
GIWNDMNEPAVFKVVTKTMPENNIHRGDDELGGVQNHSHYHNVYGMLMARSTYEGMELADENKRPFVLTRAGFIGSQRYA
ATWTGDNLSNWEHLHMSISMVLQLGLSGQPLSGPDIGGFAGNATPRLFGRWMGVGAMFPFCRGHSEAGTDDHEPWSFGEE
CEEVCRAALKRRYQLLPHFYTLFYIAHTTGAPVAAPIFFADPKDSRLRTVENAFLLGPLLIYASTLSNQGSHELQHILPR
GTWPRFDFEDSHPDLPTLYLQGGSIIPLAPPHMHVGEFSMSDDLTLLVSLDENGKAKGLLFEDDGDGYGYTKGRFLVTHY
NAERHSSIVTVKVSKAEGEWERPKRRVHVQLLLGGGAMLDAWGTDGEIIHIKVPSESEVSELISTSNERFKIHMENTKLI
PEKEVLHGQKGMELSREPVELSSGDWKLNIVPWIGGRILSMTHVPSGVQWLQSRIDINGYEEYSGTEYRSAGCTEEYSVI
ERDLEHAGEEESLILEGDIGGGLILRRNISIPKDNPRVFRIASSIEARSVGAGSGGFSRLVCLRVHPTFYLMHPTESFVS
FTSIDGSKHEVWPDSGEQLYLGNNLPHGEWMLVDKSLNLQLVNRFDVSQVFKCIIHWDCGTVNLELWSEDRPVSKASPLN
IEHEYEVTSFS*

DNA
ATGGAGAGATCATTACTGACACAAGCAGCAGTGTCATCATCACTCTCTAGCAAAACTCAAGCTTCTTCCTTCTTCTACTT
CAATGGACGCTCTCTTCCATCGCTGAATCCGATCGGTCCGTCTCCTTCGATTAGATCCTTCCCTCTCGTCAGAAGTAACC
GGAAGAAATCTTTAGTTAGAATGACTGTTAGTGGAGATAGCTCGGAATCTGTAGAGATTGGTTCGAGTGATATGATCTTC
CAGCCGATTTTGGAGCACGGTGTTTTCCGGTTTGACTGTTCTGTTGAGCATAAGAAAGCTGCATTTCCTAGTGTTTCGTT
TAAGAACAGTAAAGACCGGGAAAAGCCGATTGCATCTCGAAATGTTCCAGCGTATATTCCTACTTGTGCTTGTCTTCAGG
ACCAACAAGTTGTCACTTTTGAGTTTTCCCCTGGTACCTCGTTTTATGGGACGGGAGAAGTTAGTGGTCAGTTGGAGAGA
ACAGGGAAACGGGTGTTTACTTGGAACACTGATGCATGGGGATATGGCTCTGGAACAACTTCGTTATACCAGTCACATCC
ATGGGTACTAGTTGTCCTTCCAAACGGAGAAACACTTGGGGTTCTTGCTGATACAACACGAAAGTGTGAGATTGATCTAA
GGAAAGAGGCAAGTATAAGAATTATAGCACCAACATTATATCCTATAATCACATTTGGTCCATTCTCCTCACCCACTGCT
GTTTTGGAGTCCCTCTCACACGCCATTGGAACTGTTTTTATGCCTCCAAAGTGGGCTTTAGGCTACCACCAATGCCGTTG
GAGTTATATGTCTGACAAGCGAGTGGCCGAGATTGCTCAAACATTTCGTGACAAGAAAATTCCTTCTGACGTGATATGGA
TGGATATTGACTACATGGATGGTTTTCGTTGTTTCACATTCGACAAGGAGCGTTTCCCAGATCCATGTGCTTTGGCGAAA
GATCTCCATAATAATGGTTTTAAAGCAATCTGGATGCTAGACCCTGGAATAAAGCAGGAGGAAGGTTATGATGTGTATGA
TAGTGGGGAAAAAAATGATCTTTGGGTTAGCCGGGCAGATGGGAAGCCATTTATTGGTGAAGTATGGCCTGGGCCTTGCG
CTTTTCCTGACTATACAAATTCCAAAACTCGCACTTGGTGGGCGAATTTGGTTAAGGAGTTTGTTTCAAATGGTGTTGAT
GGTATATGGAATGATATGAATGAGCCTGCAGTTTTCAAAGTCGTGACAAAGACGATGCCTGAGAACAATATTCACCGTGG
GGATGATGAGCTTGGAGGTGTTCAAAACCACTCACATTACCACAATGTATACGGGATGCTAATGGCAAGATCAACTTATG
AAGGGATGGAGCTCGCTGATGAGAATAAGCGACCCTTTGTATTGACAAGGGCTGGTTTCATAGGTAGCCAGAGATATGCT
GCAACTTGGACAGGAGATAATCTTTCAAACTGGGAGCATTTACATATGTCTATATCCATGGTACTTCAGCTGGGGCTTAG
TGGTCAGCCCTTATCAGGGCCAGATATCGGTGGCTTTGCTGGCAATGCAACTCCGCGACTATTTGGACGTTGGATGGGTG
TTGGAGCTATGTTTCCATTCTGTCGTGGCCATTCTGAGGCTGGCACTGATGACCATGAACCGTGGTCCTTTGGAGAAGAG
TGTGAGGAAGTCTGTCGAGCCGCATTGAAGAGGCGTTACCAACTCCTACCACATTTTTACACCCTATTTTACATAGCCCA
TACAACTGGTGCTCCAGTTGCAGCTCCAATATTTTTCGCTGATCCTAAAGATTCCCGGCTAAGGACTGTTGAAAACGCCT
TTCTTTTGGGTCCGCTTCTCATATATGCAAGCACGTTGTCTAATCAGGGATCACATGAGCTGCAGCACATATTACCCAGA
GGAACTTGGCCCAGGTTTGATTTTGAAGATTCACATCCGGATTTACCAACATTATATTTACAAGGTGGATCCATCATACC
ATTGGCTCCTCCACATATGCATGTTGGGGAGTTTAGTATGTCAGATGACTTGACCCTACTTGTGTCATTAGATGAAAATG
GGAAAGCTAAAGGACTCTTGTTTGAGGATGACGGAGATGGATATGGCTACACTAAAGGCAGATTTCTAGTCACACACTAC
AATGCTGAGCGGCATTCTTCCATTGTCACTGTCAAGGTTTCAAAAGCTGAAGGAGAGTGGGAGAGGCCAAAACGCCGTGT
TCATGTCCAATTATTACTAGGAGGCGGTGCAATGCTTGATGCTTGGGGAACGGACGGAGAGATTATCCACATTAAGGTGC
CTTCAGAAAGTGAAGTTTCAGAGTTAATATCGACAAGCAATGAGCGCTTTAAAATTCATATGGAAAATACAAAATTGATA
CCTGAGAAGGAAGTGCTCCACGGACAAAAGGGAATGGAACTTTCAAGGGAGCCAGTTGAGCTAAGCAGTGGCGATTGGAA
ACTTAATATAGTTCCATGGATTGGTGGAAGGATATTGTCTATGACACATGTTCCATCAGGAGTTCAATGGCTTCAAAGCA
GGATAGATATCAATGGTTATGAAGAGTATAGTGGAACTGAGTACCGGTCAGCTGGATGTACTGAAGAATATAGTGTCATT
GAGAGGGATTTGGAACATGCAGGAGAAGAAGAATCTCTAATCCTAGAAGGTGATATAGGCGGTGGACTGATTCTTCGGCG
TAACATAAGTATACCTAAAGACAATCCCCGAGTTTTTAGGATTGCCTCCAGCATTGAGGCCCGTAGTGTTGGTGCTGGTT
CTGGTGGATTTTCAAGGCTGGTATGCTTAAGAGTCCATCCAACTTTCTATCTTATGCATCCAACTGAATCGTTTGTCTCA
TTCACGTCGATTGATGGTTCAAAGCATGAAGTTTGGCCAGATTCTGGAGAACAGTTATATTTAGGGAACAACCTTCCACA
TGGTGAATGGATGCTGGTGGACAAGAGCCTCAATCTACAGCTGGTAAACAGGTTCGATGTTAGTCAGGTCTTTAAATGTA
TTATCCACTGGGACTGTGGAACCGTTAACTTGGAGCTCTGGTCCGAAGACCGACCTGTTTCCAAGGCATCACCTCTGAAT
ATAGAGCATGAATATGAAGTCACAAGTTTCTCATAA