Details for Capsella Locus Carubv10012874m

Position : scaf_3 ( 5`- 1666464 .. 1671794 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012874m

Protein [Map View]
MSTENLLLHNSVKSDNVIRRSRASGGDAAAAAYSIGGGCQIFDELPKAMIVSVSRPDTTDFSPLLLSYTLELRYKQFKWT
LQKKASQVVYLHFALKKRLIVEELHEKQEQVREWLHSLGIVDMQGSVVQDDEEPDDGALPLNYTQDSVKNRNVPSRAAFP
IIRPTIGRSETVVDRGRTAMQGYLSLFLGNLDIVNSKEVCKFLEVSRLSFAREYGSKMKEGYVTVKHLRKFPGSDGGNCC
LLSCCLGCFRTSWTKVWAVLKPGFLALLEDPFSGKLLDIMVFDSSLFQNAKECSELPHLAEQVKERNPLRYGFKVTSGDR
TVRLRTTSCGKAKEWVKAVDEAGCNNPHRFGSFAPPRGLASDGSQAQWFVDGHTAFEAIAFAIQNATSEIFMTGWWLCPE
LYLKRPFQDHSSLRLDALLETKAKQGVKIYILLYKEVQIALKINSMYSKKRLQNIHKNVKVLRYPDHLSSGIYLWSHHEK
IVIVDYQVCFIGGLDLCFGRYDTAEHKIGDCPPHIWPGKDYYNPRESEPNSWEETMKDELDRRKYPRMPWHDVHCALWGP
PCRDVARHFVQRWNHSKRNKAPNEQTIPLLMPHHHMVLPHYLGTREIGIVAAKTKEDPEKPVVLARQDSFSSASPPQDIP
LLLPQETDADFARQGGDLKLDDGSRKDLYESNANVELPGETSEESDQDEAVNEWWWQIGKQSDCKCQIIRSVSQWSAGTS
QPEDSIHRAYCSLIQNAEHFIYIENQFFISGMEKDDTILNRVLEALYRRILKAHEENKCFRVVIVIPLLPGFQGGIDDFG
AATVRALMHWQYRTISREGTSILENLNALLGSKTQDYISFYGLRSYGRLFEDGPIATSQIYVHSKLMIVDDRIAVIGSSN
INDRSLLGSRDSEIGVVIEDKEFVESSMDGVNWMAGKFSYSLRCSLWSEHLGLHAGEMKNIQDPIKDATYKDLWMETAKK
NTDIYDQVFSCIPNEHIRSRTALRESMSLLKDKLGHTTIDLGIAPEKLKPCGSDSWERLKETKGHLVCFPLQFMCDQEDL
RPVFNETEFYTAPQVFH*

DNA
ATGTCGACGGAAAATTTGCTACTTCATAACAGCGTTAAATCGGACAACGTCATCAGAAGGAGCAGAGCTTCTGGAGGTGA
TGCGGCGGCGGCGGCGTATTCTATCGGCGGTGGATGTCAGATATTCGATGAACTTCCAAAGGCTATGATCGTCTCAGTCT
CACGACCCGACACCACCGATTTTAGTCCCTTGCTTCTTTCTTACACCTTGGAGCTTCGGTATAAACAGTTCAAGTGGACA
CTACAAAAGAAAGCTTCTCAAGTTGTATACCTACATTTCGCTTTGAAGAAACGTTTGATCGTTGAAGAACTCCACGAGAA
GCAAGAGCAGGTTAGAGAGTGGCTGCACAGCTTGGGGATCGTTGATATGCAAGGATCAGTTGTGCAAGATGATGAAGAAC
CTGATGACGGTGCTCTTCCTCTAAACTACACACAAGACAGTGTCAAGAACAGGAATGTACCTTCGCGTGCAGCGTTTCCA
ATCATCAGACCAACAATAGGCCGGTCAGAGACAGTTGTAGACCGTGGGAGAACCGCAATGCAAGGTTACTTGAGTCTCTT
TCTAGGGAACTTGGACATTGTTAACTCCAAAGAGGTCTGCAAGTTCCTGGAAGTTTCTAGACTCTCATTTGCTAGAGAGT
ACGGTTCTAAGATGAAAGAAGGATATGTCACAGTGAAGCACCTTAGGAAATTCCCCGGGTCTGATGGTGGTAATTGCTGT
CTTCTTTCATGTTGTCTCGGCTGCTTCAGAACTAGCTGGACCAAGGTTTGGGCGGTTTTAAAACCGGGATTCTTGGCATT
ACTAGAAGATCCTTTCAGCGGAAAGCTTCTAGATATAATGGTGTTTGATTCATCGCTGTTCCAGAACGCAAAGGAGTGTT
CTGAGCTGCCGCATTTGGCTGAACAGGTGAAGGAACGCAATCCGCTGCGCTATGGCTTTAAGGTGACAAGTGGGGACAGA
ACCGTGAGACTAAGAACTACAAGCTGTGGGAAAGCTAAAGAATGGGTTAAGGCCGTTGACGAAGCTGGTTGTAACAATCC
ACATCGGTTTGGCTCGTTTGCACCACCAAGAGGCTTGGCATCTGATGGAAGCCAGGCTCAGTGGTTCGTAGACGGTCACA
CTGCGTTTGAAGCCATCGCTTTTGCAATCCAAAATGCAACATCAGAGATATTTATGACTGGTTGGTGGTTATGTCCGGAG
CTATATCTCAAACGTCCCTTTCAAGATCATTCGTCATTGAGGCTCGATGCATTGCTGGAGACAAAAGCAAAACAGGGCGT
TAAGATTTATATTCTTCTCTATAAGGAAGTTCAAATCGCCCTGAAAATCAACAGTATGTACAGCAAGAAACGGCTTCAAA
ACATTCACAAGAACGTCAAAGTTCTTCGTTATCCAGACCATCTCTCCTCTGGCATTTACCTCTGGTCACACCATGAGAAG
ATAGTGATTGTAGATTACCAAGTTTGCTTCATCGGAGGATTAGATCTCTGTTTTGGCCGCTATGATACAGCGGAGCATAA
GATTGGAGATTGCCCTCCTCATATATGGCCAGGAAAGGATTATTACAATCCTAGAGAATCTGAACCAAATTCTTGGGAAG
AAACGATGAAAGACGAGCTTGACCGGAGAAAATACCCAAGAATGCCGTGGCACGATGTCCACTGTGCTCTATGGGGACCG
CCTTGTCGTGATGTGGCTCGACATTTCGTCCAGCGGTGGAATCACTCTAAGAGAAACAAGGCACCTAATGAACAGACGAT
TCCGTTGCTGATGCCTCACCACCATATGGTTCTCCCTCACTACTTGGGAACTAGAGAGATCGGTATTGTTGCAGCTAAAA
CTAAGGAAGACCCGGAAAAACCCGTTGTTCTCGCTAGACAAGACTCTTTCTCTTCAGCTTCACCGCCTCAAGATATCCCT
TTGCTTCTCCCGCAAGAAACCGATGCGGATTTCGCCAGACAAGGAGGAGATCTGAAGTTAGATGACGGTTCAAGAAAAGA
TCTGTATGAATCTAATGCTAATGTTGAGCTGCCAGGGGAAACATCAGAGGAAAGCGACCAGGACGAGGCTGTGAACGAGT
GGTGGTGGCAGATTGGGAAGCAAAGTGATTGCAAGTGTCAGATAATCAGAAGTGTTAGCCAATGGTCTGCTGGAACGAGC
CAGCCTGAAGATAGCATTCATCGAGCTTATTGTTCACTTATCCAAAACGCTGAACATTTCATCTACATTGAGAACCAATT
CTTCATCTCCGGGATGGAAAAAGATGACACGATTCTGAACCGCGTTCTCGAAGCTTTATACAGACGCATTCTGAAAGCTC
ACGAAGAGAACAAGTGCTTCCGCGTCGTGATCGTTATACCGCTCCTCCCTGGATTTCAGGGAGGTATAGATGACTTCGGA
GCAGCCACGGTTCGAGCACTGATGCATTGGCAATACCGTACCATCTCTAGAGAAGGAACTTCGATTCTTGAAAACCTTAA
CGCTTTGCTAGGTTCCAAGACGCAAGATTACATCTCCTTCTACGGTCTAAGATCGTATGGACGGTTGTTCGAGGACGGTC
CAATTGCCACTAGCCAGATTTACGTGCATAGTAAGCTAATGATTGTTGATGACCGGATCGCAGTGATTGGATCTTCTAAC
ATAAACGATCGGAGCTTACTAGGCTCACGTGACTCGGAGATTGGAGTTGTAATCGAAGACAAAGAATTTGTGGAATCTTC
GATGGACGGAGTGAACTGGATGGCCGGGAAATTCTCTTACAGTCTTAGATGTTCCTTGTGGTCAGAGCATCTCGGCCTTC
ACGCCGGGGAGATGAAAAATATCCAAGATCCAATCAAAGATGCAACATACAAAGACTTGTGGATGGAAACGGCTAAGAAG
AACACTGACATCTATGACCAAGTCTTCTCTTGCATTCCTAATGAGCATATACGCTCAAGAACTGCTTTGAGAGAGAGCAT
GTCTCTTTTGAAAGATAAGCTGGGTCACACAACGATCGACCTTGGGATTGCACCGGAAAAGCTAAAACCATGCGGCAGCG
ACTCGTGGGAGAGGCTGAAGGAGACAAAAGGGCACCTCGTGTGTTTCCCATTACAGTTCATGTGTGATCAAGAAGATCTC
AGACCGGTATTCAACGAAACCGAGTTCTACACTGCTCCCCAAGTCTTCCATTGA