Details for Capsella Locus Carubv10012870m

Position : scaf_3 ( 5`- 6778026 .. 6785116 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012870m

Protein [Map View]
MLRTVSCLASRSSASLFFRFFRQFPRSYMSLTSSTATLRAPSRSLRRISSPSVAGRRLFLRRGLRVPSTAVRSVNGQFSR
LSVRAVATQPAPLYPDVGRDEAEKLGFEKVSEEFISECKSKAILFKHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGI
PHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFFPKCVDDVHTFQQE
GWHYELNDPSEDISYKGVVFNEMKGVYSQPDNILGRIAQQALSPENTYGVDSGGDPKDIPKLTFEEFKEFHRQYYHPSNA
RIWFYGDDDPVHRLRVLSEYLDMFEASPSRDSSKIRPQKLFSQPIRLVEKYPAGRDGDLKKKHMLCVNWLLSENPLDLQT
QLALGFLDHLMLGTPASPLRKILLESGLGEALVSSGMSDELLQPQFSIGMKGVSEDNVQKVEELIMATLKKLAEEGFDND
AVEASMNTIEFSLRENNTGSFPRGLSLMLQSIAKWIYDMDPFEPLKYTEPLKALKTRIAKEGSKAVFSPLIEQFILNNSH
RVTIEMQPDPEKATQEEVEEKNILEKVKASMTEEDLAELARATEELKLKQETPDPPEALRCVPSLNLGDIPKEPTYVPTE
VGNINGVKVLRHDLFTNDIIYAEVVFDMGSLKHELLPLVPLFCQSLLEMGTKDLTFVQLNQLIGRKTGGISVYPLTSSVR
GKDEPCSKIIVRGKSMAGRAEDLFNLMNCLLQEVQFTDQQRFKQFVSQSRARMENRLRGSGHGIAAARMDAMLNIAGWMS
EQMGGLSYLEYLHTLEKKVDEDWEGISSSLEEIRRSLLARNGCIVNMTADGKSLTNVEKSVAKFLDLLPENPSGGLVTWD
GRLPLRNEAIVIPTQVNYVGKAGNIYSTGYELDGSAYVISKHISNTWLWDRVRVSGGAYGGFCDFDSHSGVFSYLSYRDP
NLLKTLDIYDGTGDFLRGLDVDQETLTKAIIGTIGDVDSYQLPDAKGYSSLLRHLLGVTDEERQRKREEILTTSLKDFKN
FAEAIDAVRDNGVAVAVASAEDIDAANNARSNFFEVKKAL*

DNA
ATGCTCCGGACAGTCTCTTGTTTAGCTTCGCGCAGCTCGGCCTCTCTATTCTTCCGCTTCTTTCGTCAGTTCCCTCGCTC
TTACATGTCTCTCACATCCTCCACGGCCACTCTTCGTGCCCCCAGTCGCAGTCTTCGCCGGATTTCCTCTCCTTCAGTCG
CCGGAAGACGTTTATTCCTCCGAAGAGGTTTGAGGGTTCCATCCACCGCTGTTCGAAGTGTCAATGGGCAGTTCTCTCGT
CTCTCTGTTCGCGCCGTCGCCACACAACCCGCACCACTTTATCCTGATGTAGGTCGAGATGAGGCTGAGAAGCTTGGATT
CGAAAAAGTGTCGGAAGAATTCATCTCTGAGTGTAAATCAAAGGCGATTCTCTTCAAACACAAGAAAACAGGTTGTGAGG
TGATGTCTGTGTCAAATGAGGATGAGAACAAGGTGTTTGGCGTTGTCTTCAGGACTCCTCCGAAGGATTCCACTGGCATT
CCGCACATACTGGAACATAGTGTTCTATGTGGGTCAAGAAAGTACCCGCTCAAAGAGCCATTTGTTGAACTACTCAAGGG
AAGTTTGCATACTTTTCTAAATGCATTCACATATCCTGATAGAACCTGCTACCCAGTTGCGTCCACAAATACAAAGGATT
TTTACAATCTTGTCGATGTATATTTGGATGCTGTCTTCTTCCCCAAGTGTGTGGATGACGTGCACACTTTTCAGCAAGAG
GGCTGGCACTATGAGCTTAATGATCCCTCAGAAGACATATCTTACAAAGGTGTTGTTTTTAATGAGATGAAAGGTGTCTA
TTCACAACCTGATAACATTTTGGGGCGAATTGCTCAACAGGCCTTATCCCCAGAAAATACATATGGTGTTGACAGTGGAG
GTGATCCAAAGGATATCCCTAAGCTGACATTCGAGGAATTTAAGGAGTTCCACCGTCAGTATTATCACCCAAGCAATGCC
AGAATCTGGTTCTATGGAGATGATGATCCTGTTCATCGCCTCCGTGTTTTGAGTGAGTACTTGGACATGTTTGAAGCAAG
TCCATCTCGCGATAGTTCGAAGATTAGACCTCAAAAGTTATTCTCTCAGCCTATCAGACTGGTTGAGAAATATCCTGCTG
GCCGAGATGGTGACCTGAAAAAGAAGCACATGTTGTGCGTTAACTGGCTATTGTCTGAGAATCCCTTGGACTTGCAAACT
CAACTTGCACTTGGGTTCTTGGATCATCTTATGCTGGGGACTCCTGCTTCACCACTAAGAAAAATCTTATTGGAGAGCGG
TTTAGGAGAAGCTCTTGTCAGTAGTGGGATGTCAGACGAACTCTTGCAACCCCAGTTCAGTATTGGTATGAAAGGTGTGT
CCGAAGATAATGTTCAAAAGGTTGAAGAGTTAATCATGGCTACTCTGAAAAAGTTGGCAGAAGAAGGGTTTGATAATGAT
GCTGTGGAGGCATCCATGAATACAATTGAGTTTTCTCTGAGGGAAAACAACACAGGATCTTTCCCTCGTGGTTTATCACT
TATGCTCCAATCTATTGCAAAATGGATATACGATATGGATCCTTTTGAGCCATTAAAGTATACAGAACCATTGAAGGCCT
TGAAAACCAGAATAGCTAAGGAGGGATCGAAGGCTGTCTTTTCCCCACTGATAGAGCAGTTTATTTTAAACAACTCGCAT
CGTGTTACCATAGAGATGCAGCCTGATCCCGAAAAAGCTACTCAAGAGGAAGTGGAAGAGAAAAATATCTTGGAAAAGGT
TAAAGCGAGTATGACAGAAGAAGATCTTGCAGAGCTAGCGCGTGCTACAGAGGAGCTGAAATTGAAACAAGAAACCCCTG
ACCCTCCTGAAGCACTGAGATGTGTCCCAAGTTTGAACTTAGGTGACATTCCAAAAGAACCTACTTATGTTCCCACTGAG
GTTGGAAATATCAATGGTGTGAAGGTTTTGCGACATGACCTTTTCACAAATGATATAATCTACGCTGAAGTAGTATTTGA
TATGGGTTCGCTGAAACATGAGCTTCTTCCGCTAGTACCACTTTTCTGTCAATCATTACTGGAGATGGGCACAAAAGATT
TGACTTTTGTGCAACTTAATCAGTTGATTGGAAGGAAAACGGGAGGGATATCAGTTTATCCCCTTACATCATCAGTTAGG
GGTAAGGATGAACCATGCAGCAAAATTATCGTACGTGGAAAATCCATGGCTGGACGTGCAGAAGACCTTTTTAACCTGAT
GAATTGCTTATTGCAAGAGGTTCAATTTACAGATCAGCAGCGGTTTAAACAATTTGTCTCTCAAAGCAGAGCACGGATGG
AGAACCGCTTGAGGGGAAGTGGTCATGGAATTGCTGCAGCGAGGATGGATGCAATGTTGAACATTGCTGGATGGATGTCT
GAACAGATGGGTGGTCTCAGTTATCTTGAATATTTACATACCCTTGAAAAGAAAGTGGATGAAGATTGGGAAGGGATTTC
ATCCTCACTTGAGGAGATCAGAAGATCTCTCCTTGCCAGGAATGGTTGCATAGTCAATATGACTGCTGATGGGAAGTCTC
TCACCAACGTCGAAAAATCTGTTGCGAAATTTCTAGATTTACTCCCTGAGAACCCATCTGGTGGGCTTGTCACTTGGGAT
GGTCGACTTCCTCTGAGAAATGAAGCTATTGTAATACCAACCCAGGTTAATTATGTTGGAAAAGCAGGTAACATATACAG
CACCGGGTATGAGCTTGACGGCAGTGCATATGTTATATCAAAGCATATTAGCAATACATGGTTATGGGACCGTGTTCGTG
TAAGTGGTGGTGCATATGGAGGTTTTTGTGATTTTGATTCGCATTCAGGGGTATTTTCTTACTTATCGTACCGGGATCCA
AACTTGTTAAAGACACTTGATATATATGATGGAACCGGAGATTTCTTACGTGGCCTTGACGTGGATCAAGAAACACTCAC
TAAAGCTATTATCGGAACCATCGGTGATGTTGATTCATACCAATTACCTGATGCTAAAGGTTATAGCAGTTTGTTGAGGC
ATTTACTTGGGGTAACTGACGAAGAACGACAAAGAAAGCGTGAGGAGATATTGACAACAAGTTTGAAAGACTTCAAGAAT
TTCGCAGAGGCAATCGATGCAGTTAGAGATAACGGTGTCGCGGTGGCTGTGGCATCCGCAGAAGACATTGATGCAGCCAA
CAATGCACGATCTAACTTTTTCGAGGTGAAGAAAGCTCTCTAA