Details for Capsella Locus Carubv10012869m

Position : scaf_3 ( 5`- 982075 .. 988358 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012869m

Protein [Map View]
MELSVSPQTQKMNLQTSRKSSLSGSRKDLWFAIREGSLVDVDLALTTLKKTGGNINLRNVCGLTPLHIAIWRNHIPIVRR
LLAAGADPDARDGESGWSSLHRALHFGHLAVASVLIDSGASFTLEDIKLRTPVDLVSGPVAQIIGEQQSSVATEVFSWGN
GANYQLGTGNQHVQKLPGRVDSLHGCFIKLVSAAKFHSVAISSHGEVYTWGFGRGGRLGHPEFDIHSGQAAVITPRQVIS
GLGSRRVKAVAAAKHHTVIATEGGSVYTWGSNREGQLGYTSVDTQATPRKVTSLKAKIVAVSAANKHTAVVSECGEVFTW
GCNREGQLGYGTSNSASNYSPRLVDYLKGKVFTAVASSKYHTLVLRNDGEVYTWGHRLVTPRRVIISRNLKKAGNTLLNF
HRRRPLRLTAIAAGMVHSLALAEDGALFYWVSSDSNLRCQQLHLLHGKTVVSISAGKYWASAVTSTGEVYMWDGKNVNDM
PPSPSRLHNLKRATTVAVGETHLLVVGSLYHPAYAPTVLGKSQTVQANESREEEDEELDEGFMFNDVESVNVLKSVQHDD
PKERTVPSLKSLCEKVAAECIVEPRNAIQLLEIADSLGAEDLKKYCEDIVIRNLDFILTFSPQSIANTSPDVLANLEKLL
DDRSSETWSSRPLPTPTATFPVVIDSEEEESESDILRTRDNHVKYFSSIAEGSTRMDSFLQPEDELTERNSKEVRALRKK
LQQIEILEAKQSRGQLLDGQQIAKLQKKLDIESSLVELGIPIEESPEAKSSTALPLDGKANKKGKKKKKGKQRFVQVETF
PEFGEVKVDIDTMQVKETEEISQAIKPKDEKIMLDMTVISGFPKESDFVSLSEKKDNLPNSPRSKKLGTAANKKKNRKGG
LSMFLTGALDDQIPKPVVTPPTKPKFEGPVWGGAKISKGLSTLRDIQDEQSKTRLQEPVRTTKNQSGDDSSGKTEGKILL
SSFLTTKPIPVESAKSLQQSDMERGTPPWVSSETPRNLSRPSLRDIQMQEEKKLQSLSHSPKTKTSGFTVATGQGSPSDS
PGTNRWFKPEIDAPSPIRSIQIEEKAMKDLRRFYSSVKVVRNQP*

DNA
ATGGAATTGTCCGTCTCTCCTCAAACCCAGAAGATGAACTTGCAAACTTCCCGTAAAAGCTCACTTTCAGGGTCTAGGAA
AGATTTGTGGTTTGCTATACGAGAAGGGTCATTGGTTGATGTGGATTTAGCACTTACCACGTTGAAGAAGACCGGTGGCA
ATATTAATTTAAGGAATGTATGTGGTCTGACTCCTCTGCATATTGCCATCTGGAGAAATCACATTCCTATTGTTAGGAGA
CTGCTTGCAGCTGGTGCTGATCCAGATGCTAGGGATGGAGAATCTGGTTGGAGTAGTCTTCATAGAGCTTTGCATTTTGG
TCATCTTGCAGTAGCTAGCGTACTAATTGACTCAGGTGCTTCTTTTACTCTAGAAGACATAAAACTGCGAACACCTGTTG
ATTTGGTCTCAGGTCCAGTGGCTCAGATTATTGGCGAGCAACAGAGTTCGGTGGCTACCGAGGTTTTCAGCTGGGGAAAT
GGTGCAAACTACCAACTTGGAACTGGCAATCAACATGTTCAGAAGCTACCCGGCAGAGTTGATTCACTGCATGGTTGTTT
TATTAAGTTGGTCTCTGCTGCAAAGTTCCATAGTGTTGCCATTAGTTCTCATGGAGAAGTATACACGTGGGGATTTGGAA
GGGGTGGCCGCCTTGGACATCCTGAATTTGACATTCACAGTGGTCAAGCTGCGGTTATTACTCCCCGCCAGGTGATATCC
GGTTTAGGATCACGCCGTGTAAAGGCAGTTGCGGCAGCTAAGCACCACACTGTCATTGCTACGGAAGGCGGGAGTGTATA
CACCTGGGGTTCCAATAGAGAGGGGCAGCTTGGTTATACTTCTGTGGATACTCAGGCAACACCCCGCAAAGTGACTTCCT
TGAAGGCAAAGATTGTAGCTGTTTCTGCAGCAAACAAACATACCGCCGTAGTTTCAGAGTGCGGTGAAGTTTTCACTTGG
GGATGCAACAGGGAAGGTCAGCTTGGTTATGGAACCTCCAACTCAGCATCAAACTATTCTCCCAGATTGGTTGATTACTT
GAAAGGAAAAGTTTTCACGGCTGTTGCATCTTCAAAATATCACACTCTAGTGTTGCGAAACGATGGAGAGGTGTACACCT
GGGGTCATCGGCTGGTGACTCCAAGACGTGTTATTATTTCCCGGAATTTAAAGAAAGCTGGGAATACACTATTGAACTTT
CATCGAAGGAGACCTCTCCGATTGACTGCAATAGCTGCGGGAATGGTACACAGCTTGGCTCTAGCAGAAGATGGTGCATT
ATTTTATTGGGTTTCCTCCGACTCCAATCTTAGATGCCAACAGTTGCATTTGCTGCACGGTAAAACAGTTGTGAGCATTT
CAGCGGGTAAATACTGGGCATCTGCTGTTACTAGTACAGGTGAAGTTTACATGTGGGATGGAAAAAATGTTAATGATATG
CCACCGTCCCCTTCTCGCCTCCACAACTTGAAAAGGGCAACCACAGTTGCTGTTGGTGAAACACATCTTCTGGTTGTGGG
TTCTCTGTATCATCCTGCCTATGCTCCTACTGTGCTTGGGAAGTCTCAAACTGTGCAAGCGAATGAAAGTAGGGAAGAAG
AAGATGAAGAACTTGATGAGGGTTTTATGTTTAATGATGTGGAATCTGTGAATGTGTTAAAATCTGTGCAACACGATGAT
CCTAAGGAGAGGACGGTACCTAGTTTGAAAAGTTTATGCGAGAAGGTGGCAGCAGAATGTATTGTAGAGCCACGAAATGC
TATTCAACTGCTTGAAATTGCAGATTCACTTGGAGCAGAGGACCTTAAGAAGTACTGTGAGGACATTGTGATCCGAAACC
TTGACTTTATTTTGACGTTTTCACCCCAATCAATTGCAAATACATCACCTGATGTTCTTGCCAATCTTGAGAAATTATTG
GATGACAGATCATCTGAAACATGGAGCTCCCGACCACTTCCAACACCAACAGCCACATTTCCTGTTGTTATAGATAGTGA
AGAGGAGGAAAGTGAGAGCGACATTCTAAGAACTCGTGACAACCATGTGAAATACTTTTCCAGTATTGCTGAGGGAAGTA
CTCGAATGGATTCATTCTTGCAACCAGAAGATGAGTTGACTGAACGCAATTCCAAAGAAGTCCGAGCTTTGAGGAAAAAG
TTGCAACAAATTGAGATCCTTGAAGCAAAACAATCCAGAGGACAACTTCTTGATGGTCAGCAAATAGCAAAACTTCAAAA
GAAACTAGATATTGAAAGTTCACTTGTAGAACTTGGTATTCCTATTGAAGAGTCTCCAGAGGCAAAATCATCAACAGCTT
TGCCACTAGATGGAAAAGCCAACAAGAAGGGAAAAAAGAAGAAAAAAGGAAAACAGAGGTTTGTACAGGTTGAGACATTC
CCTGAATTTGGTGAAGTTAAAGTGGATATAGATACAATGCAGGTTAAAGAAACTGAGGAAATCTCTCAAGCTATCAAGCC
AAAGGATGAAAAAATCATGTTGGATATGACGGTGATTAGTGGGTTCCCCAAGGAATCAGACTTTGTCTCACTCTCGGAGA
AGAAAGATAATTTACCCAATTCGCCGAGAAGCAAGAAACTTGGAACAGCAGCAAACAAGAAGAAGAACAGAAAGGGTGGG
CTTTCCATGTTCTTAACTGGTGCTCTTGATGATCAGATCCCTAAACCTGTTGTTACTCCTCCAACAAAGCCTAAGTTTGA
AGGTCCTGTGTGGGGTGGAGCTAAGATTTCTAAAGGATTATCAACCCTCCGGGATATTCAAGATGAACAAAGCAAGACTC
GGCTTCAGGAACCTGTTAGGACAACTAAAAATCAGTCAGGCGATGATTCTTCTGGTAAAACCGAAGGAAAGATATTACTG
AGTTCCTTCTTGACTACGAAGCCGATTCCAGTGGAATCAGCCAAAAGTTTGCAGCAATCTGATATGGAAAGAGGGACTCC
TCCTTGGGTTTCCTCTGAAACTCCTCGTAACCTGTCTCGACCTTCTCTCAGAGATATCCAGATGCAGGAGGAGAAGAAGC
TACAGTCTCTGTCCCACAGTCCAAAGACAAAAACATCAGGCTTCACTGTCGCAACCGGGCAAGGATCTCCATCAGATTCC
CCTGGAACTAATCGCTGGTTCAAACCAGAGATAGATGCTCCATCACCCATACGATCAATCCAAATCGAAGAAAAAGCCAT
GAAGGATCTCCGTCGCTTCTACAGCAGCGTGAAGGTAGTCAGAAACCAGCCTTGA