Details for Capsella Locus Carubv10012864m

Position : scaf_3 ( 5`- 816868 .. 825735 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012864m

Protein [Map View]
MGDPLERLGSLASMATESGMKEDLCVEIDPPLTESVATAEDWRRSLGKVVPAVVVLRTTACRAFDTESAGASYATGFIVD
KRRGIILTNRHVVKPGPVVAEAMFVNREEIPIYPVYRDPVHDFGFFSYDPSAVQFLSYEEIPLAPEAASVGLEIRVVGND
SGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLQRVV
RAFSFLQKSIDSCTDKPKAVHIPRGTLQMTFVHKGFDEIRRLGLRSETEQVVRHASPTGETGMLVVDSVVPSGPADKHLE
PGDVLVRVNGTVLTQFLSLENLLDDGVGQILELEIERGGQPLSVSVSVQDLHSITPDHFLEVSGAVIHPLSYQQARNFRF
PCGLAYVADPGYMLFRAGVPRHAIIKKVANEDISGLGDLVSVLSKLSKGARVPLEYMSHTDRHRKKSVLVTIDRHEWYAP
PQLYTRNDSSGLWDVKPAIEPAAVAPSIGNNGLPISQNISICHHDTEPMHEVNVRGVTDIAAIMEASGGDGSQNDFGSEA
KKQRVDDDSLDGIAANGSLYGSEFKSDDAMATDNTVLRDFEGATALSANASLAERAIEPALVMFEVHVPPSCSLDGVHSQ
HFFGTGIIIYHSSSMGLAVVDKNTVAISASDVMLSFAAFPVEIPGEVVFLHPVHNYALIAYNPSAMGPASASVIRAAELL
PEPALQRGDSVYLVGLSRNLQATSRKSIVTNPCAALNIGSADSPRYRATNMEVIELDTDFGSSFSGALTDEQGRIRAIWG
SFSTQVKYSSTSSEDHQFVRGIPVYAISQVLEKIITGGNGPALLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDEWI
QILVKKDPVRRQVLRVKGCLAGSKAENLLEQGDMVLAVNKMPVTCFSDIEAACQTLDKGSHNDENLSLTILRQGQEMELV
VGTDKRDGNGTTRAINWCGCVVQDPHPAVRALGFLPEEGHGVYVTRWCHGSPAHRYGLYALQWIVEVNGKKTPDLNAFAD
ATKELEHGQFVRIRTVHLNGKPRVLTLKQDLHYWPTWELRFDPESALWRRNILKALK*

DNA
ATGGGAGATCCGTTGGAGAGATTGGGATCACTGGCGTCAATGGCTACTGAGTCTGGCATGAAGGAGGACTTGTGCGTTGA
GATCGATCCTCCGTTAACTGAATCCGTTGCCACCGCCGAAGACTGGCGTCGTTCTCTCGGCAAGGTTGTTCCCGCCGTCG
TCGTACTCCGCACAACGGCCTGCCGCGCCTTCGACACCGAGTCCGCCGGTGCCAGCTATGCTACTGGGTTCATCGTTGAT
AAGCGACGTGGGATCATCCTCACCAATCGCCATGTGGTTAAGCCTGGCCCAGTAGTTGCTGAGGCAATGTTTGTGAACCG
CGAAGAAATCCCAATCTATCCTGTATATAGAGACCCGGTCCATGACTTTGGCTTCTTTTCCTATGATCCCAGTGCAGTAC
AGTTTCTGTCTTATGAAGAAATTCCTCTTGCCCCAGAGGCGGCTTCTGTTGGACTTGAAATTAGGGTTGTTGGAAATGAT
AGCGGAGAAAAGGTTTCCATACTGGCTGGTACTCTTGCGCGGTTGGATAGGGATGCTCCACATTACAAAAAAGATGGTTA
TAACGACTTCAATACGTTTTATATGCAAGCAGCATCAGGTACTAAAGGTGGTTCAAGTGGTTCTCCTGTCATTGATTGGC
AAGGCAGGGCGGTAGCTTTGAATGCTGGCAGCAAGTCATCAAGTGCATCTGCCTTCTTCCTACCACTTCAACGGGTTGTT
AGGGCGTTCAGTTTTCTCCAAAAAAGCATTGACTCGTGCACGGATAAGCCAAAAGCAGTTCATATTCCTCGTGGTACACT
TCAGATGACATTTGTTCATAAAGGATTCGATGAGATACGGAGACTTGGTCTCAGGAGCGAAACTGAACAGGTGGTTCGAC
ATGCATCTCCAACTGGGGAAACAGGAATGCTTGTTGTTGATTCTGTGGTGCCAAGTGGCCCTGCTGATAAACATTTGGAG
CCGGGAGATGTTCTTGTTCGTGTGAATGGGACAGTGCTAACACAATTTTTAAGCTTGGAGAATTTGCTTGATGATGGTGT
TGGCCAGATACTTGAATTGGAGATTGAAAGGGGTGGACAGCCACTATCTGTTAGTGTATCAGTTCAGGATTTACACTCAA
TCACTCCAGACCACTTCCTGGAAGTAAGCGGTGCTGTAATTCATCCGTTGTCTTATCAGCAGGCTCGCAATTTTCGTTTT
CCTTGTGGCCTGGCTTATGTTGCGGACCCTGGATACATGCTATTTAGAGCTGGGGTCCCTCGACACGCTATCATAAAGAA
GGTTGCTAATGAGGACATTTCTGGTCTGGGGGATTTAGTATCTGTTCTCTCAAAGCTCTCCAAAGGTGCTCGTGTTCCCT
TGGAATATATGTCTCACACTGATCGTCATCGCAAGAAGTCTGTGTTAGTCACAATTGATCGTCATGAATGGTACGCTCCT
CCGCAGTTGTATACCCGTAATGACAGTTCTGGTTTATGGGATGTGAAACCTGCAATTGAACCTGCTGCTGTTGCGCCATC
TATTGGTAATAATGGCTTGCCTATAAGCCAAAATATTTCTATCTGCCATCACGATACAGAACCCATGCATGAAGTGAATG
TTCGTGGGGTTACTGATATTGCAGCTATTATGGAAGCCTCTGGTGGGGATGGTTCTCAGAATGATTTTGGCTCGGAAGCA
AAGAAACAAAGAGTTGACGATGATTCTCTAGATGGAATTGCTGCAAACGGTTCGTTATATGGCAGTGAATTTAAATCTGA
TGATGCAATGGCAACAGATAATACAGTTTTAAGAGACTTCGAAGGTGCAACAGCACTTTCTGCTAATGCTTCCTTGGCTG
AGCGTGCTATTGAGCCTGCTCTTGTCATGTTTGAGGTTCATGTGCCACCATCGTGCAGTCTTGATGGTGTACACTCACAA
CATTTCTTTGGGACTGGCATCATTATATATCATTCTTCTAGCATGGGACTTGCTGTGGTGGACAAAAACACTGTTGCAAT
TTCTGCATCTGATGTTATGTTGTCGTTTGCTGCTTTTCCAGTCGAGATTCCTGGAGAGGTGGTATTTCTTCATCCTGTTC
ACAACTATGCTCTTATTGCCTATAATCCATCAGCAATGGGTCCTGCCAGTGCTTCAGTCATTCGTGCAGCTGAGCTACTG
CCTGAACCTGCACTGCAACGTGGAGATTCAGTGTATCTTGTCGGATTGAGTAGAAATCTTCAAGCCACATCGAGAAAATC
TATTGTAACCAATCCATGTGCAGCCTTAAACATTGGCTCTGCTGATTCTCCACGCTACAGAGCTACTAATATGGAAGTAA
TCGAGCTTGATACAGATTTTGGTAGCTCATTTTCAGGAGCGCTGACTGATGAGCAGGGAAGGATAAGGGCCATTTGGGGA
AGCTTTTCGACTCAGGTTAAATATAGTTCCACTTCGTCAGAAGACCATCAGTTTGTCAGAGGTATCCCGGTATATGCAAT
CAGCCAAGTCCTTGAAAAAATCATAACCGGTGGAAATGGACCAGCTCTTCTCATAAATGGTGTCAAAAGGCCAATGCCGC
TTGTTCGGATTTTGGAAGTTGAGTTGTATCCTACTTTGCTCTCAAAAGCCCGGAGTTTCGGTTTGAGTGATGAATGGATC
CAAATCCTAGTCAAGAAAGATCCTGTTAGACGTCAAGTTCTGCGTGTTAAAGGTTGCCTGGCAGGATCAAAAGCTGAAAA
CCTTCTAGAGCAAGGCGACATGGTTCTGGCAGTCAATAAGATGCCAGTTACATGCTTCAGTGACATAGAAGCCGCTTGTC
AAACGTTGGATAAGGGCAGCCACAACGATGAAAATCTCAGTCTAACAATCCTTCGACAGGGCCAAGAAATGGAGCTCGTA
GTTGGAACTGATAAAAGAGATGGGAACGGAACTACAAGAGCAATAAACTGGTGTGGATGTGTTGTTCAGGATCCCCATCC
TGCGGTTCGTGCTCTCGGATTTCTTCCGGAGGAAGGTCATGGTGTCTATGTCACAAGATGGTGTCACGGAAGTCCTGCAC
ATCGATATGGCCTCTATGCACTTCAATGGATTGTGGAGGTGAACGGGAAGAAGACTCCCGACCTAAACGCATTCGCAGAT
GCCACCAAGGAGCTAGAGCACGGGCAGTTTGTGCGTATTAGGACTGTTCATCTTAACGGCAAGCCACGAGTCTTGACTCT
GAAACAAGATCTCCATTACTGGCCTACTTGGGAGCTGAGGTTCGACCCAGAGAGTGCTCTTTGGCGGAGAAATATATTGA
AAGCCTTGAAGTAA