Details for Capsella Locus Carubv10012862m

Position : scaf_3 ( 5`- 5772312 .. 5776488 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012862m

Protein [Map View]
MGDGEEMKLADGDRTSDGEVEKRELVGSDQVMDIEEEVFEEAIGSQEGLKPEPFGADEDLPLEAACSSNERGVQDLEVSY
TVVGESHSEVDVQHLITKDAESDLVTSKMNDDQGGTGAEISFGKIESSLDVVEKSDEATSNVSSLAAEAVTLQNGNIHSF
SENTIVVPDNKELVAEVISVNSCSEETGDDGIKKYGMGTEQEIEEGEGTHKNCFQKGFVCIENDETGADYNGVKKTSGDE
SLNDCIEVATAILSPLEKSSSEEKIKTEDHSSSGFPGETFREQETFHNMNGVHDVQQSTQSKEIEKQQDSRVNVGPEMKE
SQHVDRESEVLSSVSPAEARSNTAALPPARPAGLGHAAPLLEPAPRVPQQPRVNGNVYQNQPQQAEDSTTAETDEHDETR
EKLQLIRVKFLRLAHRLGQTPHNVIVAQVLYRLGLAEQLRGRNGSRVGAFSFDRASAMAEQLEVAGQDPLDFSCTIMVLG
KSGVGKSATINSIFDELKISTDAFQMGTKRVQNVEGFVQGIKVRVIDTPGLLPSWSDQHKNEKILKSVRAFIKKNPPDIV
LYLDRLDMQSRDSGDMPLLRTITDVFGPSIWFNAIVGLTHAASAPPDGPNGTASSYEMFVTQRSHVIQQAIRQAAGDMRL
MNPVSLVENHSACRTNRAGQRVLPNGQVWKPHLLLLSFASKILAEANALLKLQDNIPGGQFAARSKAPPLPVLLSSLLQS
RPQAKLPEEQYDDEEDEDDLDESTDSDEEPEYDDLPPFKWLTKAEMAKLSKSQKKEYLDEMDYREKLFMKRQMKEERKRR
KLLKKFAAEIKDMPNRYSENVEEERSEPASVPVPMPDISLPASFDSDNPTHRYRYLDSSNQWLVRPVLETHGWDHDIGYE
GVNAERLFVVKEKIPISFSGQVTKDKKDANVQVELASSVKHGEGRSTSLSLDMQNAGKDLAYTVRSETRFNNFRKNKAAA
GLSVTLLGDSVSAGLKVEDKLIANKRFRMVMSGGAMTSRGDVAYGGSLEAQFRDKDYPLGRFLSTLGLSVMDWHGDLAIG
GNVQSQVPIGRSSNLIARANLNNRGAGQVSVRVNSSEQLQLAMVALVPLFKKLLSYYSPEKMQY*

DNA
ATGGGCGATGGGGAAGAGATGAAGCTTGCTGATGGTGATAGAACTAGTGATGGGGAAGTAGAGAAAAGGGAGTTGGTGGG
ATCTGATCAAGTGATGGATATTGAAGAAGAGGTCTTCGAGGAAGCAATTGGTTCGCAGGAGGGACTAAAACCTGAACCTT
TCGGAGCCGATGAGGATTTGCCATTAGAGGCAGCATGTAGTAGCAATGAGAGAGGAGTACAAGATTTAGAGGTTAGTTAT
ACGGTGGTGGGAGAGAGCCATAGCGAGGTTGACGTGCAACATCTAATTACGAAGGATGCTGAATCTGATTTGGTGACTTC
CAAAATGAATGATGATCAGGGGGGGACAGGTGCAGAAATTTCTTTTGGTAAAATCGAATCAAGCTTGGATGTGGTTGAGA
AGAGTGATGAAGCTACTTCCAATGTTTCCAGTTTAGCGGCTGAGGCTGTAACTTTACAAAACGGGAACATACATTCTTTT
TCGGAAAACACAATTGTGGTTCCTGATAATAAAGAACTGGTGGCTGAAGTTATCTCAGTAAATTCCTGCTCCGAGGAAAC
AGGGGATGATGGTATTAAAAAATATGGCATGGGAACAGAACAAGAGATTGAGGAAGGTGAAGGAACACATAAGAATTGCT
TTCAGAAGGGTTTCGTATGTATAGAAAATGATGAGACTGGTGCCGACTACAATGGTGTTAAAAAGACTTCAGGTGACGAA
TCCTTGAATGATTGTATTGAAGTAGCAACTGCGATCCTATCTCCTTTGGAAAAATCTAGCTCCGAGGAAAAGATAAAGAC
TGAAGATCACAGCAGTAGTGGCTTCCCTGGGGAAACTTTTAGAGAACAGGAGACTTTTCACAATATGAATGGAGTACATG
ATGTTCAGCAGAGTACTCAATCTAAGGAAATTGAAAAGCAGCAAGACAGCAGAGTAAATGTAGGTCCAGAGATGAAGGAA
AGCCAACATGTGGATAGAGAATCTGAGGTATTAAGTTCTGTTTCACCAGCAGAGGCTAGAAGTAATACTGCAGCATTACC
ACCGGCTCGCCCAGCAGGTCTTGGTCATGCTGCTCCTCTTTTGGAACCGGCACCACGTGTTCCACAACAGCCTCGTGTCA
ACGGAAATGTGTATCAGAATCAGCCTCAGCAAGCTGAAGACTCTACCACTGCAGAGACAGATGAGCATGATGAGACGCGT
GAGAAGCTCCAGTTGATCAGGGTCAAATTTTTGAGGCTTGCACATAGATTAGGGCAAACTCCACATAATGTTATTGTTGC
TCAGGTTTTGTACAGGCTTGGATTGGCTGAACAGTTGAGGGGAAGAAACGGAAGCCGTGTTGGTGCCTTTAGTTTTGATC
GTGCCAGTGCCATGGCAGAACAGCTCGAAGTAGCTGGACAGGATCCCCTTGATTTCTCTTGTACGATTATGGTGCTCGGT
AAAAGTGGGGTTGGTAAAAGTGCAACTATCAATTCTATTTTCGATGAACTGAAAATTAGTACTGATGCATTCCAGATGGG
GACAAAGAGGGTTCAGAATGTTGAGGGTTTTGTTCAGGGAATTAAGGTACGGGTAATTGACACCCCTGGTCTCTTACCAT
CCTGGTCAGATCAACACAAGAATGAGAAGATCCTGAAGTCTGTCAGGGCATTCATCAAGAAAAACCCGCCTGACATTGTA
TTATATCTTGATAGATTGGATATGCAAAGCAGAGATTCTGGTGACATGCCTCTCTTGCGCACCATCACTGATGTTTTTGG
ACCATCAATATGGTTTAATGCCATTGTGGGTTTGACTCATGCCGCTTCGGCTCCACCAGATGGCCCAAATGGTACTGCTT
CTAGCTATGAAATGTTTGTTACACAACGTTCTCATGTCATCCAGCAGGCCATTCGCCAAGCAGCTGGAGATATGAGGCTC
ATGAATCCTGTTTCTTTAGTTGAGAACCACTCTGCTTGCAGGACCAATCGGGCAGGCCAGAGAGTATTACCTAATGGCCA
AGTGTGGAAACCTCATTTGCTATTACTCTCATTTGCCTCCAAGATTCTAGCCGAAGCAAATGCTCTTCTGAAATTACAAG
ATAATATTCCAGGGGGACAATTTGCAGCTCGGTCCAAGGCTCCTCCATTACCAGTTCTCCTCTCATCGCTTCTGCAATCA
AGACCACAAGCTAAGCTTCCTGAGGAGCAGTACGATGATGAAGAAGATGAAGATGATTTGGACGAATCAACAGATTCTGA
CGAAGAACCAGAGTATGATGACCTTCCTCCATTTAAGTGGTTGACTAAAGCCGAGATGGCTAAACTTAGCAAATCCCAGA
AGAAGGAATATCTCGATGAGATGGATTACCGGGAGAAATTATTTATGAAGAGGCAGATGAAAGAGGAAAGAAAGAGACGT
AAGTTGTTAAAGAAATTTGCTGCTGAGATTAAAGATATGCCTAACAGGTATAGTGAAAATGTGGAAGAGGAGAGAAGTGA
ACCTGCATCTGTTCCAGTTCCCATGCCAGATATATCTCTACCTGCATCGTTTGACTCTGACAATCCTACTCACCGGTACC
GGTACCTTGATTCCTCCAATCAATGGCTTGTTAGGCCAGTCCTGGAAACTCATGGGTGGGATCATGATATTGGTTATGAA
GGTGTGAATGCGGAACGACTTTTTGTTGTTAAAGAAAAAATACCGATATCTTTCTCTGGTCAAGTGACAAAGGACAAGAA
GGATGCAAATGTGCAGGTGGAATTGGCCAGCTCGGTTAAACATGGAGAGGGTAGATCAACTTCCTTAAGTTTGGACATGC
AAAATGCAGGGAAGGACTTGGCGTACACTGTTCGAAGTGAAACTAGATTTAACAATTTTAGGAAAAACAAAGCGGCAGCT
GGTCTCTCTGTAACGCTCTTGGGTGATTCGGTGTCTGCAGGGCTGAAAGTAGAAGATAAGTTGATTGCTAATAAACGGTT
CAGAATGGTTATGTCTGGTGGGGCAATGACTAGTCGAGGAGATGTTGCCTATGGTGGTAGTTTAGAAGCTCAGTTTAGAG
ATAAAGATTATCCGCTTGGTCGGTTTTTGTCAACTCTTGGACTTTCTGTGATGGATTGGCATGGCGATCTTGCTATCGGA
GGGAATGTACAGTCCCAAGTGCCCATCGGACGTTCCTCTAATTTAATTGCTCGTGCTAATTTGAATAACAGAGGGGCAGG
GCAAGTAAGCGTCCGCGTAAACAGCTCTGAGCAGCTCCAACTTGCTATGGTAGCACTTGTTCCTCTGTTCAAGAAGCTTC
TTAGTTATTATTCCCCAGAGAAAATGCAATATTGA