Details for Capsella Locus Carubv10012859m

Position : scaf_3 ( 5`- 7086912 .. 7090883 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012859m

Protein [Map View]
MTTTTPEKTPARPLSVQDWDVLIDDFRDAGAPRDWFTSVFQVDSLVDFALSSLLKRDFPTPVKLSILVFLDEFSPILFHK
CGSETFDRFVDVLRTIVQSPTDGSSGLKEQAMVSFTSVLVSIDSFSVGHVEGVVDLLLALVNRPNHGFDRQARAVACECL
RQLEKAFPGLLSDVAGHLWSLCQAERTHAVQAYLLLFTTIVYNVVNQKLKVSLLSTSVPLVPFNAPNWMRDQSLVMSQGQ
GLGPDQKELRRTLAFLLESPYLFTSCAMMEFMGMVVPLASALELQASMLKVQFLGMIYSFDPMLCHVVLLMYSQFPDAFE
GQEKEIMRRLMLFSKETQNYLVFRLLALHWLMGLLNKLMLSGELEKRKSVLEMGQKFHPVVFDPLALKALKLDLLVQCSV
SSNALSGGDNSKSAGDLLQDCLVSVSDFKWLPPWSSETELAFRTLHKFLICASTHSDTDPSTTRSLMESSLFQNVQGLLV
DMTLEFQILVPVIVAFIERLINCHKHQWLGERFLQTVDEKLLPKLKKNNLLTAYFPLFHRIAENDTIPPSRLIELLTKFV
ISLVEKRGFDVGLKLWDQGTEVLGICRTLMSHHKSSRLFLGLSRLLSLTCLYFPDLEVRDNARIYLRMLVCIPGQRFKNI
LKPADAVSPSTHSSTFFSVQSPRFRHDPNKSRNLSAYIHLERVIPLLVKQSWSLSLPSLSVGTDGYSIAENKIQVDEVEP
DGSQELQILPEARRIESGKPTLRVMDSKIAEILERLRRYFSVIPDFKHMPGIKVRITCTLRLDAEPYNSIWGGEAQNIDL
EKVDSPPAIFASVLKFSSSAPYGSIPSCRIPFLLGEPHPNSNAPNEEVSLDIVLVENTLKEEEKDGLRGAPVTVELEPRE
PTPGLVEVSMEANAENGQMIQGKLESVPVGIEDMFLKAFAPPDEPEDTLPSYYSDLFNALWEVCGSSSSTAHETFALKGG
KTAAAISGTRSVKLLEVPAETVIQATELRLAPFVVAISGEQLVNIVRDGGIIENIVWKEEEEEQRDHANADQSSSSSVGG
MGLNRGPLRLTYIGYGDDQEVPMTRSRGKMGKIKMLMFLPQRYHLLFEMEVGEGSTLVQIRTDYWPCLAYVDDYLEALFL
Q*

DNA
ATGACCACTACGACGCCGGAGAAGACTCCGGCGAGACCTCTCTCTGTCCAGGACTGGGACGTTCTCATCGACGACTTCCG
AGACGCCGGCGCTCCTCGCGACTGGTTCACTTCCGTTTTCCAGGTTGATTCTCTGGTGGACTTCGCTCTCTCCTCTCTCC
TCAAGAGAGACTTCCCTACCCCTGTGAAGCTCTCAATCCTTGTCTTTCTCGACGAATTTTCCCCGATTTTGTTTCATAAA
TGTGGTAGCGAGACCTTTGATCGCTTCGTCGATGTTCTCCGTACGATCGTGCAATCCCCGACGGATGGATCGTCGGGATT
GAAGGAGCAAGCTATGGTTTCTTTCACCTCTGTGCTTGTATCGATTGATTCTTTCTCTGTAGGTCACGTTGAAGGAGTTG
TTGATTTGCTGCTTGCGCTCGTTAATCGTCCTAACCACGGGTTTGATCGACAAGCTCGTGCTGTCGCGTGTGAGTGTTTA
CGCCAGCTCGAAAAAGCTTTTCCTGGTCTGCTATCCGATGTCGCTGGTCATCTTTGGTCGTTGTGCCAGGCTGAAAGAAC
TCACGCCGTGCAAGCTTACCTTCTCTTGTTCACTACGATTGTCTACAACGTGGTCAATCAGAAGCTTAAGGTTTCCCTTC
TTAGTACCTCTGTACCGTTGGTGCCTTTCAATGCTCCTAATTGGATGCGTGATCAGAGTTTGGTTATGAGTCAAGGTCAA
GGATTGGGGCCAGATCAGAAGGAACTGAGACGAACGCTGGCTTTTTTGTTGGAATCTCCGTATTTGTTCACGTCTTGTGC
TATGATGGAATTTATGGGTATGGTTGTGCCACTTGCATCAGCATTGGAGTTGCAGGCCTCTATGCTGAAAGTTCAATTCT
TGGGCATGATTTATTCGTTTGATCCAATGCTTTGTCATGTTGTCTTGCTTATGTACTCTCAGTTCCCTGATGCCTTCGAG
GGACAAGAGAAAGAGATAATGAGACGTCTTATGCTCTTTTCCAAGGAGACTCAGAACTATCTTGTTTTCCGCTTGCTTGC
GTTGCACTGGTTAATGGGTTTGCTGAATAAGCTTATGTTGAGTGGGGAGCTTGAGAAGAGGAAATCTGTTCTTGAGATGG
GTCAGAAGTTTCATCCTGTGGTTTTTGATCCACTCGCTTTGAAAGCGTTGAAGCTTGATCTGCTGGTACAATGCTCTGTT
AGTTCCAATGCTTTGAGTGGAGGTGATAACAGCAAATCTGCTGGGGATTTGTTGCAGGACTGCTTAGTATCGGTTTCAGA
TTTCAAATGGTTGCCTCCATGGAGCTCAGAAACTGAACTAGCATTCCGCACTTTACACAAGTTTCTGATATGTGCATCTA
CACATTCTGACACTGACCCTTCCACCACTAGAAGTCTTATGGAGTCTAGCCTCTTCCAAAACGTGCAGGGGTTGCTGGTA
GACATGACTTTGGAGTTTCAGATCTTGGTCCCTGTTATTGTGGCTTTTATTGAGCGGTTGATAAACTGTCACAAGCATCA
GTGGTTAGGAGAGCGGTTCCTTCAGACAGTCGATGAGAAACTGCTTCCCAAACTTAAGAAAAACAATTTATTAACAGCTT
ACTTCCCACTTTTCCATCGGATAGCCGAGAATGATACAATACCTCCTTCTCGATTGATAGAGCTGCTTACGAAGTTTGTA
ATTTCACTTGTTGAAAAGCGGGGGTTTGATGTGGGGTTGAAATTGTGGGATCAAGGAACTGAAGTTCTTGGCATTTGTCG
AACACTGATGAGTCACCATAAGAGCTCTAGATTATTTCTTGGACTCTCTCGCCTTCTTTCCCTCACATGTCTCTATTTCC
CTGATCTAGAGGTCCGAGACAATGCTAGGATATATCTGAGGATGCTGGTCTGTATACCCGGACAGAGATTTAAGAACATT
TTGAAGCCCGCAGATGCCGTCTCTCCATCAACTCATTCTTCTACATTCTTTAGTGTTCAAAGTCCTCGTTTTCGTCATGA
TCCTAACAAATCTCGGAACCTTTCAGCTTATATTCATCTTGAACGGGTGATACCCCTACTCGTGAAACAGTCATGGTCAT
TGTCTCTACCATCTCTAAGTGTTGGAACTGATGGATATAGCATTGCAGAAAACAAAATCCAGGTAGATGAGGTTGAGCCT
GATGGCAGTCAAGAACTCCAGATTTTGCCAGAAGCTCGAAGAATTGAGTCAGGAAAACCTACGTTAAGGGTAATGGACTC
AAAGATTGCAGAGATTCTAGAAAGATTAAGAAGGTATTTCTCAGTGATTCCTGATTTCAAGCACATGCCTGGAATTAAGG
TTAGAATAACCTGTACTTTGAGATTGGATGCTGAACCATATAACAGTATATGGGGTGGTGAAGCTCAGAATATCGATTTA
GAGAAAGTCGACTCACCTCCTGCGATTTTTGCGAGCGTGCTCAAGTTCTCATCTTCAGCCCCGTATGGCTCTATTCCCTC
ATGCCGCATACCTTTCCTTCTCGGTGAGCCTCATCCGAACAGCAATGCACCCAATGAAGAAGTGTCTTTAGACATCGTCC
TGGTAGAAAACACGCTAAAAGAGGAGGAGAAAGATGGCTTGAGAGGAGCACCTGTAACAGTGGAACTGGAACCTAGAGAA
CCTACACCAGGTTTGGTCGAGGTTTCAATGGAAGCAAATGCAGAGAATGGTCAGATGATTCAGGGCAAACTCGAGAGTGT
CCCTGTTGGGATCGAAGACATGTTCCTAAAAGCTTTTGCTCCACCAGACGAACCTGAAGATACATTGCCGAGCTACTACT
CAGATCTATTCAATGCTTTGTGGGAAGTGTGTGGTTCTTCGTCCAGCACTGCACACGAAACGTTTGCACTAAAAGGAGGC
AAAACCGCTGCAGCAATCAGTGGGACTCGGTCAGTAAAACTGCTTGAAGTCCCTGCTGAAACTGTAATACAGGCCACCGA
GCTTCGCTTAGCGCCCTTTGTGGTGGCTATAAGCGGAGAACAGCTTGTAAACATTGTGAGAGACGGAGGAATTATCGAGA
ACATTGTGTGGAAAGAAGAGGAAGAAGAACAAAGGGATCACGCAAATGCAGACCAGTCTTCTTCGTCCTCGGTGGGGGGC
ATGGGATTAAACCGAGGCCCTCTTCGTCTGACATATATTGGATATGGAGATGACCAAGAGGTTCCGATGACAAGGAGCAG
AGGGAAAATGGGAAAAATAAAGATGTTAATGTTTCTACCGCAGAGATATCATCTGCTGTTTGAAATGGAAGTTGGGGAAG
GATCGACATTGGTGCAGATAAGAACAGATTATTGGCCTTGCTTGGCTTACGTTGATGATTACTTAGAAGCTTTGTTTTTG
CAGTAG