Details for Capsella Locus Carubv10012856m

Position : scaf_3 ( 5`- 9200202 .. 9207894 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012856m

Protein [Map View]
MQRQRSILSFFQKPSPATASTQGLVSGDATSGGGGGGGGGGLRSTVKGGDGNGDASVRPAVSKSVDEVRGTDTPPEKVPR
RVLPSGFKTTAESAGGGASSSLFSNIMHKFVKVDDRDCPGQRSREHVVPLDDSSVCVKDDNVFPEFRSNKCQSQERGHAF
SFSGRANIRLVEDIEVDDDVPGPDTPGMRPSVPRFKRVLEDGMNSKENKVPVLDSNKRLKMLQDPVCGEKKEVNEGTKFE
WLDPSRIRDANRRRPDDPLYDRKTLYIPPDVFKKMSASQKQYWSVKSQYMDIVLFFKVGKFYELYELDAELGHKELDWKM
TMSGVGKCRQVGISESGIDEAVQKLLARGYKVGRIEQLETSDQAKARGANSIIPRKLVQVLTPSTASEGNIGPDAVHLLA
IKEIKMELEKCSTVYGFAFVDCAALRFWVGSISDDASCAALGALLMQVSPKEVLYDSKGLSREAQKALRKFTLTGSTAVQ
LAPVPQVMGDTDAAGVRNIIESNGYFKASSQSWNCAVDGLNECDVALSALGELINHLSRLKLEDVLKHGDIFPYQVYRGC
LRIDGQTMVNLEIFNNTCDGGPSGTLYKYLDNCISPTGKRLLRNWICHPLKDVVTINKRLDIVEEFKANSEIMQITGQYL
HKLPDLERLLGRIKSSVQSSASVLPALLGKKVLKQRVKAFGQIVKGFRSGIDLLLALQKESNMMSLLCKLCKLPILVGKS
GLELFLSQFEAAIDSDFPNYQNQDMTEENAETLTILIELFIERSTHWSEVIHTISCLDVLRSFANVASLSAGSMARPVII
PESNSSNQNQEIKGPILKIQGLWHPFAVAADGQLPVPNDILLGEASSSSNSIHPRSLLLTGPNMGGKSTLLRATCLAVIF
AQLGCYVPCETCELSLVDTIFTRLGASDRIMTGESTFLVECTETASVLQNATQDSLVILDELGRGTSTFDGYAIAYSVFR
HLVEKVQCRMLFATHYHPLTKEFSSHPRVISKHMACAFKSRTDQEPRGCDKDLVFLYRLTEGACPESYGLQVALMAGIPN
QVVETATDAAQAMKRSIGESFKSSELRSEFSSLHEEWLKSLVCISRTTNTIVEDEEDEEDDYDTLFCLWHELKSSYSVPQ
LKSMT*

DNA
ATGCAGCGCCAGAGATCGATTTTGTCTTTCTTCCAGAAACCGTCGCCGGCGACGGCGAGTACTCAGGGTTTGGTTTCGGG
AGATGCTACTAGCGGCGGTGGCGGCGGCGGAGGAGGAGGAGGGTTACGATCTACTGTGAAGGGAGGGGATGGTAACGGCG
ACGCTTCGGTACGCCCTGCTGTATCGAAATCTGTTGATGAGGTTAGAGGAACGGATACTCCGCCGGAGAAGGTTCCGCGT
CGTGTCTTGCCGTCCGGATTTAAGACGACGGCTGAATCCGCCGGAGGTGGTGCTTCGTCGTCGCTGTTCTCTAATATTAT
GCATAAGTTTGTGAAGGTCGATGATCGAGATTGTCCTGGACAGAGGAGCCGAGAACATGTTGTTCCGCTTGATGATTCGT
CCGTATGTGTGAAGGATGATAATGTTTTTCCTGAATTTCGTTCCAATAAATGTCAGTCTCAAGAAAGAGGACATGCTTTT
AGCTTCAGTGGGAGAGCTAATATAAGGCTAGTAGAAGATATCGAAGTAGATGATGATGTTCCTGGTCCAGATACACCAGG
GATGCGTCCAAGTGTTCCTCGTTTTAAGCGAGTTTTGGAGGACGGAATGAATTCTAAGGAGAATAAGGTCCCTGTATTGG
ATTCTAACAAAAGGCTGAAAATGCTTCAAGATCCAGTTTGTGGAGAGAAGAAAGAAGTAAACGAAGGAACCAAATTTGAA
TGGCTTGACCCTTCTCGAATCAGGGACGCCAATAGAAGACGGCCTGATGATCCCCTTTATGATAGGAAGACCTTATACAT
ACCACCTGATGTTTTCAAGAAAATGTCTGCATCGCAAAAGCAATATTGGAGTGTCAAGAGTCAGTATATGGATATTGTCC
TGTTCTTTAAAGTGGGAAAATTTTATGAGCTGTATGAGCTAGATGCAGAATTAGGACACAAGGAGCTTGACTGGAAGATG
ACCATGAGCGGTGTGGGAAAATGCAGACAGGTTGGCATCTCTGAAAGTGGGATAGATGAGGCAGTGCAAAAGCTGTTAGC
TCGTGGATATAAAGTTGGACGAATTGAGCAGCTAGAAACATCTGACCAAGCAAAAGCCAGAGGTGCTAATAGTATAATTC
CAAGGAAGCTTGTTCAGGTGTTAACTCCATCAACAGCAAGTGAGGGTAACATCGGGCCTGATGCCGTCCATCTTCTTGCT
ATAAAAGAGATCAAAATGGAGCTAGAAAAGTGTTCAACTGTGTATGGATTTGCTTTTGTTGACTGTGCTGCCTTGAGGTT
TTGGGTTGGGTCCATCAGCGATGATGCATCTTGCGCTGCTCTTGGAGCTTTATTGATGCAGGTTTCTCCAAAGGAAGTTT
TATATGACAGTAAAGGGCTATCAAGAGAAGCCCAAAAGGCTCTAAGGAAATTTACATTGACAGGGTCTACGGCGGTACAG
TTGGCTCCAGTACCACAAGTGATGGGAGATACGGATGCTGCTGGAGTTAGAAATATAATAGAATCTAATGGATACTTTAA
AGCTTCTTCTCAATCATGGAACTGTGCTGTTGATGGTCTAAATGAATGTGATGTTGCCCTTAGTGCCCTTGGAGAGCTAA
TTAATCATCTGTCTAGGCTAAAGCTAGAAGATGTACTTAAGCATGGGGATATTTTTCCATACCAAGTTTATAGGGGTTGT
CTCAGAATTGATGGCCAGACGATGGTAAATCTTGAGATATTTAACAATACCTGTGATGGTGGTCCTTCAGGGACCTTGTA
CAAATATCTTGATAACTGTATTAGTCCAACTGGTAAGCGGCTCTTAAGGAATTGGATCTGCCATCCACTTAAAGATGTAG
TAACCATCAATAAACGGCTTGATATAGTTGAAGAGTTCAAGGCAAACTCAGAAATTATGCAAATCACTGGCCAGTATCTC
CATAAACTTCCAGACTTAGAAAGATTGCTCGGGCGCATTAAGTCTAGCGTTCAGTCATCAGCCTCTGTTTTGCCTGCTCT
TCTGGGGAAAAAAGTGCTGAAACAACGAGTTAAAGCATTTGGGCAAATTGTGAAAGGGTTCAGAAGTGGAATTGATTTGT
TGTTGGCTCTACAGAAGGAATCAAATATGATGAGTTTGCTTTGTAAACTCTGTAAACTTCCTATATTAGTTGGGAAAAGT
GGGTTAGAGCTATTCCTTTCTCAATTCGAAGCAGCCATAGATAGCGACTTTCCAAATTATCAGAACCAAGATATGACAGA
GGAGAATGCTGAAACTCTCACAATACTTATTGAATTATTTATCGAAAGATCCACTCACTGGTCTGAGGTCATTCACACCA
TAAGCTGCCTTGATGTCCTGAGATCTTTTGCAAACGTTGCAAGTCTCTCTGCTGGAAGCATGGCCCGACCTGTTATCATT
CCCGAATCAAATAGTTCAAATCAGAATCAGGAAATAAAAGGGCCAATACTTAAAATCCAGGGACTATGGCATCCATTTGC
AGTTGCAGCTGATGGTCAATTGCCTGTTCCAAATGATATACTCCTTGGTGAGGCTAGCAGCAGCAGCAACAGCATTCATC
CTCGGTCATTGTTACTGACAGGACCCAACATGGGTGGAAAATCAACTCTTCTGCGTGCAACATGTCTTGCTGTTATCTTT
GCCCAGCTTGGTTGTTATGTTCCTTGTGAGACATGTGAACTCTCCCTTGTGGATACTATCTTCACAAGGCTTGGCGCATC
TGATAGAATCATGACTGGAGAGAGTACCTTCTTAGTAGAATGCACTGAGACGGCGTCAGTTCTTCAGAATGCAACTCAGG
ATTCACTAGTAATCCTTGACGAACTGGGCAGAGGAACTAGTACTTTCGATGGCTACGCCATTGCATATTCAGTTTTTCGT
CACCTGGTAGAGAAAGTCCAGTGCCGGATGCTCTTCGCAACGCATTACCACCCTCTCACAAAGGAATTCTCGTCTCACCC
ACGCGTCATCTCAAAACACATGGCTTGCGCATTCAAATCAAGAACAGATCAAGAACCCCGTGGTTGTGATAAAGACCTGG
TGTTCTTGTACCGTTTAACCGAGGGAGCTTGTCCCGAGAGCTACGGACTTCAAGTAGCCCTCATGGCTGGAATACCAAAC
CAAGTCGTTGAGACAGCAACAGACGCTGCTCAAGCCATGAAGAGATCAATTGGAGAAAGCTTCAAGTCAAGTGAGCTAAG
GTCTGAGTTCTCAAGTCTGCATGAAGAATGGCTCAAGTCATTGGTGTGTATCTCTCGAACTACCAATACAATTGTCGAAG
ATGAAGAAGATGAAGAAGATGACTACGACACGTTGTTTTGCTTATGGCATGAGCTCAAATCATCTTACTCTGTTCCCCAA
CTAAAGTCGATGACGTAA