Details for Capsella Locus Carubv10012855m

Position : scaf_3 ( 5`- 7758221 .. 7767393 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012855m

Protein [Map View]
MAPSRSKKSKYKKTPRSKAVSPQKDDENMSKTKQRKRKLSDMLGPQWSKEELERFYEGYRKFGKEWKKVAAFVHSRSAEM
VEALYTMNKAYLSLPEGTASVVGLNAMMTDHYSVLHGGSDSEQENNEGTETPRSAPKRSKVKSSDHPSTGLEGLSDRLQF
RSSSGFLPSLKKRRTETLPRAVGKRTPRIPISYTLEKDTRERYLSTVKRGLSQKGDDTDDDMEHEIALALAEASQRGGST
KNSYTPNKKAKMYLSDNKGERMRADIDLAIAKLRAGDMEDVHCEPSSESTEADNADYSGGRNDLTHGEGTSATEVQQTGR
KYYRRRLGIKKEDAKEACSGTDEAPSLGALDEKFEPERDEKFLKLTYKFSRRKSKKSLFTADEDTACDALQTLADLSLMM
PETATDTESSVQVEEKRAGKAYVSDLKGTDPASIKSSFHRNSKQRRSGSSDLCNTEAERKSPSSSLIRKRRQKTPPAKVT
KDELAASSQVIEPCNNKGIGEGNKPVGRGKRSASIRNSHEKKPVKPQDRTFSSNNIVEEDESAPSNAVIKKQVNLPTKVR
SRRKIVTEKPLTIDDGKNSETLEKFSHCISSERARRWCLFEWFYSAIDYPWFARQEFVEYLDHVGLGHVPRLTRVEWGVI
RSSLGKPRRFSAQFLKEEKEKLYLYRDSVRKHYDELNTGMREGLPMDLARPLNVSQRVISLHPKLREIHDGSVLTVDHCR
YRIQFDHPELGVEFVKDTECMPLNPLENMPASLAKHYAFPNYHIQNTSEEKMQERVKESTPEGHLKLSCETGHLLSPPNY
NISNSLKQEKVDISSLNPQALDGVDEALDLPLLNSQPSTIGHIQAREADVQALSELTRALDKKELVLRELKCMNNEVVES
QKDGHNALKESESFKKQYAAVLFQLSEINEQVSLALLGLRQRNTYQENVPYASIRHMSQSGEPDGQLTYIDSYASDTNGF
HVSEIVETSRIQARKMVYRAVQALASLRKDENNVVTMEEVIDFVNNHLSIDQTEVSSVHQRQGAQDQRLPFTLNSPSSTP
ANDIHQNPPDQNDLQIPSELVSRCMATLLMIQRCTERQFPPSEVAQVLDSAVASLQPCCSQNLPIYTEIQKCMGIIRNQI
LALVPS*

DNA
ATGGCGCCTTCAAGATCAAAGAAATCTAAGTACAAGAAAACTCCCAGGAGTAAAGCTGTCTCTCCTCAAAAAGACGACGA
AAATATGAGCAAAACCAAACAACGGAAGAGGAAGTTGTCGGATATGTTAGGTCCTCAGTGGAGCAAGGAAGAGTTGGAGC
GCTTTTATGAAGGATACCGCAAATTTGGAAAAGAATGGAAAAAGGTGGCTGCGTTTGTACATAGCCGTTCTGCAGAAATG
GTAGAGGCCCTATACACTATGAATAAGGCTTACTTGTCTCTTCCCGAGGGCACTGCTTCTGTGGTTGGCCTAAATGCGAT
GATGACTGATCACTATTCTGTTCTGCATGGAGGAAGTGACAGTGAGCAGGAAAATAATGAAGGTACTGAAACTCCGAGGT
CAGCCCCTAAGCGCTCTAAAGTAAAATCCTCTGATCATCCCTCTACAGGATTAGAGGGTCTGTCTGATCGCTTGCAATTC
AGGTCTTCTTCAGGCTTCTTGCCATCGCTAAAAAAGAGACGTACTGAGACTCTGCCTCGTGCTGTTGGAAAAAGGACTCC
TAGAATTCCTATCTCATATACCCTTGAGAAGGATACTAGGGAAAGATATTTATCAACTGTTAAGAGGGGTCTAAGTCAGA
AGGGAGATGATACTGATGACGATATGGAACATGAGATTGCATTAGCATTGGCTGAGGCTTCGCAACGAGGTGGCTCTACA
AAGAACTCCTACACACCAAATAAAAAAGCAAAGATGTACCTTTCTGATAATAAGGGTGAAAGAATGCGTGCCGATATTGA
CTTGGCAATCGCCAAGCTTCGTGCTGGTGATATGGAAGATGTGCACTGTGAACCAAGCTCAGAAAGCACTGAAGCTGATA
ATGCGGATTATTCTGGAGGAAGAAATGACTTGACGCATGGAGAAGGTACTAGTGCCACAGAAGTGCAGCAAACAGGAAGA
AAATACTATAGGAGGAGATTAGGCATTAAAAAAGAAGATGCAAAAGAAGCCTGCAGTGGTACAGACGAAGCACCAAGTTT
AGGTGCCCTCGATGAGAAATTTGAACCAGAAAGGGATGAGAAGTTTTTGAAACTCACATATAAATTTTCAAGGAGAAAAA
GTAAAAAGAGTCTCTTTACTGCAGATGAAGACACAGCATGTGATGCTCTCCAGACGCTGGCAGATCTTTCCCTCATGATG
CCTGAAACTGCCACAGATACTGAGTCATCGGTTCAAGTTGAGGAAAAGCGAGCTGGAAAAGCTTATGTGTCAGATTTAAA
AGGGACTGATCCAGCATCCATTAAAAGTAGTTTTCATAGAAACTCCAAACAGAGAAGATCAGGTAGCAGTGATCTTTGTA
ATACTGAAGCGGAAAGAAAAAGTCCCAGTAGCTCTTTAATCAGAAAGAGACGGCAGAAAACACCACCAGCTAAAGTTACG
AAAGATGAGCTTGCTGCAAGCTCACAAGTCATAGAGCCTTGCAATAACAAGGGAATAGGTGAGGGAAATAAGCCTGTTGG
GAGAGGTAAACGATCTGCAAGTATTCGAAACTCACATGAAAAGAAGCCTGTTAAACCTCAAGATCGTACTTTCTCAAGTA
ACAACATAGTGGAAGAAGATGAGTCAGCTCCATCAAATGCAGTCATTAAAAAACAAGTTAACTTGCCAACTAAAGTTAGG
AGCAGAAGAAAGATAGTAACTGAGAAACCTCTTACTATTGATGACGGGAAAAATTCTGAGACTCTAGAGAAGTTTTCGCA
TTGCATTTCTAGTGAACGAGCACGAAGATGGTGTCTTTTTGAGTGGTTCTACAGTGCAATTGATTATCCATGGTTTGCCA
GACAAGAATTTGTTGAGTATCTGGATCATGTAGGGTTGGGTCATGTTCCTAGATTAACTCGCGTGGAATGGGGTGTCATA
AGGAGTTCCCTTGGCAAACCAAGGCGATTTTCTGCACAGTTTTTGAAGGAGGAAAAAGAAAAGCTATACCTGTACAGGGA
CTCTGTAAGAAAACATTATGATGAACTAAACACGGGCATGAGGGAAGGACTTCCAATGGATTTGGCTCGGCCTCTAAATG
TTTCACAGAGAGTCATTTCCCTGCATCCAAAGTTGAGAGAGATTCACGACGGCAGTGTCCTAACTGTTGATCACTGTAGG
TACCGGATTCAGTTTGACCACCCTGAATTAGGGGTGGAATTTGTTAAGGATACTGAATGCATGCCACTGAATCCCCTAGA
AAACATGCCAGCATCACTTGCAAAGCACTATGCCTTCCCAAACTATCACATTCAGAATACTAGTGAGGAGAAAATGCAAG
AGCGGGTAAAGGAAAGCACGCCAGAAGGACATCTCAAACTTTCGTGTGAGACAGGCCATCTCTTATCCCCACCAAATTAT
AACATTAGCAATTCCTTAAAACAGGAAAAGGTTGATATCTCGAGTTTAAATCCACAAGCTCTAGACGGAGTCGATGAGGC
TCTTGATTTACCATTGTTGAATTCCCAGCCTTCAACTATTGGACATATCCAGGCAAGAGAAGCTGATGTCCAAGCTCTCT
CTGAACTGACACGTGCCCTTGACAAGAAGGAGCTAGTTTTGAGGGAGCTAAAGTGCATGAACAACGAAGTTGTGGAAAGT
CAGAAAGATGGACATAATGCTTTAAAGGAGTCTGAATCTTTTAAGAAACAATATGCAGCGGTTCTCTTTCAGCTAAGCGA
AATCAATGAGCAGGTTTCATTGGCACTTCTTGGCTTGAGGCAACGGAATACTTACCAAGAGAATGTACCATATGCATCAA
TAAGACACATGAGTCAATCAGGGGAACCTGATGGCCAGTTGACCTACATAGACAGTTACGCATCAGACACTAATGGATTC
CATGTGTCTGAGATCGTCGAAACTTCTAGAATACAAGCACGGAAAATGGTATACAGAGCTGTACAGGCATTGGCGTCGCT
GAGGAAAGACGAAAATAATGTTGTAACTATGGAAGAAGTCATTGATTTTGTAAATAATCATCTCTCAATAGATCAAACAG
AAGTATCATCAGTCCACCAAAGACAAGGTGCACAGGATCAGCGTCTTCCCTTTACACTAAATTCACCTAGTTCAACTCCT
GCCAATGATATCCATCAAAACCCACCCGACCAAAATGACCTACAAATCCCGTCTGAACTAGTTTCGCGCTGTATGGCTAC
ATTACTTATGATTCAGAGATGTACAGAGAGGCAATTCCCACCAAGTGAAGTGGCCCAGGTTCTAGACTCGGCGGTGGCGA
GTTTGCAGCCTTGCTGCTCGCAGAACCTTCCGATCTATACAGAGATTCAGAAATGCATGGGGATCATTAGAAACCAGATC
CTTGCCCTCGTACCCTCCTAA