Details for Capsella Locus Carubv10012851m

Position : scaf_3 ( 5`- 9129710 .. 9133364 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012851m

Protein [Map View]
MDMTTCVARRTRSRTESYLNSILNKSKGIGDSEGSLNSRTGQKSMRDACLPSPRKKKRRRRKVSEDEDDDDDVEFIRTDY
PEGKRVGECIVDGVGSNFEVLESKSLDCGDKVCDFDIDDDNLRGEEKTSNFKPLSPHDDDVVFVGTIPGENEHVEEGGNV
GSASVMSPRVCDFDVDDGNLRGEEKTSPLNPLSPDEDVVFIGTNSKENERVEDSNVGSGVCDILLDDINLRGGKKISEYD
EVVSLSIDSVEESGTDSGEEVSGRDRDSGESHSDGEDADSDSSDYVVESSDSSDVDSSDSGLVCSEDEERDAEGDARDVA
KEKKNPSEKVYNHKKSRTSRRENNLHVFNLLAKSIWESTYILGEDICSGDKTAEVDCREDVLIRESLSEKVNEQGKPRER
RSFHRVKEKNHLTGETFVAGEKLCDGQETIDCLTKESPPVNLRFGCEEPVLIEKTEEEKELDSLWEDMTLALTLEGMHSS
TPAKNGDMLCSKETHDFVLDEEIGLKCCHCSYVAVEIKDISPAMEKYRPRVNDNTKCRDKKGDPLPNRLEFDASDPSRYV
APLDNTEGTVWQYVPGIKDTLYPHQQEGFEFIWRNLAGTTKLNELNTVGVKESGGCIISHKAGTGKTLLTIVFLLSYLKR
FPDSHPVVIAPATLMRTWEEEFKKWNTNIPFYNMNSLQFSKYEDASAVSRLNGNRQHNSIRMVKLYSWWNQKSVLGVSYP
LYEKLAANKNAGEMQVFRKMLLELPGLLVLDEGHTPRNQNSLIWKVLTEVRTEKRIILSGTLFQNNFKELSNVLCLARPS
LKDTISSRLQELGKWSQEGEHGRVNEEIGLVDFKAVIAPFVHFHEGNILQESLPGLRDCVVVLNPPFQQKKILDRIDTFQ
NTFEFEHKLSAVSVHPSLYLCCNPTKKEDLVIGPAALGILKRIRLDYKEGVKTKFLIDFIYISQTVKEKVLVYSQYIDTL
KLIMEQLSVVFGWTEGKEILFMHGKVEQRDRQHLINNFNNPDSESKVLLASTKACSEGISLVGASRVVFLDVVWNPSVES
QAISRAYRIGQKRAVFIYHLMVKDTSEWNKYCRQSEKYRISELVFSSTNENDKPINNKVSEDRILDEMVQLEKLKDIFEK
ILYYPRESDMFTGIF*

DNA
ATGGATATGACTACTTGTGTTGCTAGAAGAACTCGATCGAGAACTGAGTCTTACTTGAACTCGATTCTGAATAAATCAAA
AGGGATTGGTGATTCTGAGGGTTCGTTAAATTCGAGGACGGGGCAGAAGAGCATGCGCGATGCTTGTTTGCCATCTCCGA
GGAAGAAGAAACGGCGGCGGAGAAAAGTGAGTGAGGATGAAGACGACGACGACGATGTTGAATTTATCAGAACTGATTAT
CCAGAAGGTAAGCGAGTGGGTGAATGTATTGTTGATGGTGTTGGTTCTAATTTTGAGGTTTTGGAATCGAAATCGCTTGA
TTGTGGTGATAAGGTTTGTGATTTTGATATCGATGATGATAATTTGAGAGGTGAGGAGAAAACTTCGAATTTTAAGCCTT
TGTCTCCTCATGATGATGATGTTGTTTTTGTTGGGACTATCCCGGGAGAGAATGAGCATGTAGAGGAAGGTGGCAATGTT
GGTTCTGCTTCGGTTATGTCTCCTAGGGTTTGTGATTTTGATGTTGATGATGGTAATTTGAGGGGTGAAGAGAAAACTTC
TCCTTTGAATCCTTTGTCTCCGGATGAAGATGTTGTTTTTATCGGGACTAACTCGAAAGAGAACGAACGTGTTGAAGATA
GCAATGTTGGTTCCGGGGTTTGTGATATTCTTCTGGATGATATTAATTTGAGGGGTGGGAAGAAGATTTCTGAGTATGAT
GAGGTTGTAAGTCTGAGTATTGATTCTGTGGAGGAATCAGGGACGGATTCAGGCGAGGAAGTTAGTGGCCGAGATAGGGA
TTCTGGTGAAAGTCATAGTGATGGTGAAGATGCTGATTCTGACTCATCTGATTACGTGGTGGAGTCTTCAGATTCTTCTG
ATGTAGATAGCTCTGATAGTGGTCTCGTTTGTTCTGAGGATGAAGAGAGGGATGCAGAGGGTGATGCCAGAGACGTTGCT
AAAGAAAAAAAGAACCCAAGTGAAAAAGTATACAACCATAAAAAGTCGAGGACTTCTCGTAGGGAGAATAACTTGCATGT
GTTTAACCTGCTAGCTAAATCTATTTGGGAGAGCACATACATTTTGGGGGAAGACATTTGCTCAGGGGACAAAACAGCAG
AGGTTGATTGTAGAGAAGATGTTTTAATTAGGGAGAGCCTAAGTGAAAAGGTAAATGAACAGGGGAAACCAAGGGAACGG
AGGAGTTTCCATAGGGTGAAGGAGAAGAACCACTTGACGGGTGAGACTTTTGTTGCTGGCGAAAAACTATGTGATGGACA
AGAGACAATAGACTGCTTGACAAAAGAATCACCTCCTGTAAACTTGAGATTCGGCTGTGAGGAGCCTGTGCTTATCGAGA
AAACAGAGGAGGAGAAAGAATTAGACAGCTTGTGGGAAGATATGACCCTTGCTCTAACATTGGAAGGAATGCACTCATCT
ACTCCTGCTAAAAATGGAGATATGTTATGTAGCAAAGAGACGCACGACTTTGTCCTGGATGAGGAAATTGGTTTGAAATG
CTGCCACTGTTCTTATGTGGCTGTCGAGATCAAAGACATCTCACCAGCCATGGAAAAGTATCGTCCTCGTGTTAATGACA
ATACGAAATGTAGAGATAAAAAGGGTGACCCTTTACCTAACAGGCTTGAGTTTGATGCTTCAGATCCCAGCAGATATGTT
GCCCCTTTGGATAATACAGAAGGAACTGTTTGGCAATATGTCCCTGGCATCAAAGATACTTTGTACCCACACCAACAAGA
AGGTTTTGAATTTATCTGGAGGAACTTAGCTGGGACAACAAAACTTAATGAGTTAAACACCGTAGGGGTTAAGGAAAGTG
GCGGATGCATTATTTCGCACAAGGCTGGAACTGGTAAGACACTCTTGACCATCGTTTTTCTTCTGTCATACTTAAAACGG
TTCCCAGATAGCCATCCTGTGGTCATAGCTCCTGCAACTCTAATGCGTACGTGGGAAGAAGAATTCAAGAAATGGAACAC
AAATATCCCATTTTATAACATGAATAGTCTGCAGTTCTCAAAGTATGAGGACGCTTCAGCTGTCTCACGTTTAAATGGAA
ATAGGCAACATAACTCCATCCGTATGGTTAAGTTATATTCGTGGTGGAATCAGAAAAGCGTACTTGGAGTTAGCTACCCT
CTGTATGAGAAGCTCGCGGCAAATAAGAACGCTGGAGAAATGCAAGTGTTTAGGAAGATGTTGCTAGAATTGCCGGGGTT
GCTGGTCCTTGACGAGGGCCACACTCCCAGAAACCAGAATAGTCTCATTTGGAAAGTGCTTACTGAAGTCAGAACAGAAA
AGCGTATCATTCTTTCAGGGACACTGTTCCAAAATAATTTCAAGGAACTTTCTAATGTCTTATGCCTGGCAAGACCATCT
TTGAAAGATACGATATCTTCGAGACTACAAGAACTTGGCAAGTGGAGCCAAGAAGGAGAACACGGAAGGGTGAACGAAGA
AATTGGATTGGTGGATTTTAAGGCTGTGATTGCTCCTTTTGTGCATTTCCACGAAGGAAACATCCTTCAAGAAAGCCTTC
CAGGTCTAAGAGACTGTGTTGTGGTGTTGAACCCGCCTTTTCAACAGAAGAAAATTCTAGACAGAATTGATACTTTTCAA
AACACATTTGAATTTGAGCACAAGCTTTCAGCTGTTTCAGTACACCCATCTTTGTATTTGTGCTGCAATCCGACAAAGAA
GGAAGACTTGGTTATTGGGCCTGCAGCATTAGGAATTCTGAAGAGGATTAGACTTGACTACAAGGAAGGTGTGAAAACAA
AGTTCCTTATCGACTTCATATACATCAGTCAAACAGTGAAAGAGAAAGTGTTGGTGTATAGCCAATACATTGACACTCTA
AAGTTGATCATGGAGCAGCTCAGTGTAGTATTTGGCTGGACTGAAGGGAAAGAAATTCTCTTTATGCATGGTAAAGTTGA
ACAAAGAGACAGGCAGCATCTGATCAACAACTTCAACAATCCAGACAGTGAATCTAAAGTTCTACTGGCATCAACAAAAG
CATGTTCCGAGGGTATCAGTCTAGTTGGCGCTTCAAGAGTTGTGTTTCTTGATGTCGTTTGGAACCCTTCTGTTGAAAGC
CAAGCCATAAGTCGAGCTTACAGAATTGGCCAAAAGCGTGCTGTGTTCATTTACCATCTCATGGTTAAAGACACATCTGA
GTGGAACAAGTACTGTAGGCAAAGTGAGAAATATCGCATATCCGAACTGGTCTTCTCTTCTACCAATGAGAATGATAAGC
CGATTAACAACAAAGTGTCTGAAGATAGAATCCTCGACGAGATGGTTCAACTCGAGAAGCTGAAAGACATCTTTGAGAAG
ATACTTTATTACCCAAGGGAATCTGACATGTTTACCGGCATCTTCTGA