Details for Capsella Locus Carubv10012846m

Position : scaf_3 ( 5`- 6171846 .. 6176984 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012846m

Protein [Map View]
MKMSNTPEAGDGAPVTTGGLFPVLPTSPKSISAISSTPQWLRNASFTTDLSVINAGASTAPSVSVVDEDEDEEGDPDGYT
FEANQPKVYNLVEEEASWESDDDKGKRKGDKKKKRKSGGTAPDESRSKKSSVRDSDEYYSKPVKDYYLDTRPDPDNLVYG
SIYRMNVPRYKLDNSQRVSGTGSLRFYLRNRRSSMLDTEIDIDSLEGRAKSDTRYWYAKHAAMERNKNFKRIRLSASREA
VDSNFDHFIPLEEGEAVQESDEEDVLSKDSTMGASWEDDVLDKTREFNKMTRERPHDEKAWLAFANFQDKVSSMQSQKGV
RLQTLEKKISILEKAFELNPDSEELLLALLKAYRSRDNADALISRWEKALMQNSASYKLWREFLCVVQGEFSRFKVSEVR
KMYSYAIQALSSACNKRHRQVDTTSEPLDSAAIQQELVLVDMLVSLCRFEWQAGYQELATALFQAELEFSIFCPSLLLTE
QSKLRLFEHFWSSNGARVGEEGAFGWSLWLEKEEENRHKILKEESSDDNDVGGWTGWTEQVSGRNGDSIASANTVEVDVA
RESLDEEMDDENSKPEDDTEAMLKSLGINVNAAASDEVKDTSTWVKWFEEEVSRDLSQWMPTRKAGEFSSVDEMGEGEDE
EQLSSVVLYEDINGYLFSLRSDEARLSLVYQFIDFFGAHIPPWTSSNSLSWSEKISSLETLSDSMLENLRSVHECLSKSD
STNGFSLGSLLGGSCDISMRTEMMKFLRNAILLCLNVFPRNYILEEAVLVAEELFVTNMNTCDAATTPCQALAKRLLKSD
RQDLLLCGVYAQREAASGNMKHARRVFDMALTSICGLPKELQYNASLLCLWYAESEIANSSLRAKDTESSSRAMHILCYL
GSGLAYVPYTSQSSSMQILRARQGFREKLKKIQSAWSHGVTDDQSAALVSSAALFEELTNDLSAAVEILEHMFSSVLPGR
KSQSHQLELLFNYYVRMLQRHQDDLTLSQLWKPISEGLQQYPLNPELYRALVDICNRRMTSHRLRMMFDDYSRKSSSAVV
WLFALSYELSKGGSSHRIRGLFERAFAQDTLKNSVILWRCYIAYEMDIAHNPSAARRIYFRAINACPWSKKLWLDGFRKL
SSVLTVKEMSDLQEVMRDKELNIRTDIYEILLMQG*

DNA
ATGAAGATGTCGAATACACCAGAGGCCGGCGACGGAGCTCCGGTAACTACAGGTGGATTGTTCCCCGTCCTTCCTACTTC
GCCGAAATCCATCTCAGCTATTTCCAGTACTCCTCAATGGCTCCGCAACGCCAGCTTCACGACGGATCTCTCCGTCATCA
ACGCCGGCGCTTCGACCGCTCCTTCCGTATCCGTGGTCGACGAAGACGAAGATGAAGAAGGAGATCCTGATGGGTATACT
TTTGAAGCTAATCAGCCTAAGGTTTACAATCTGGTTGAAGAAGAAGCGTCCTGGGAGTCTGATGACGACAAGGGGAAGAG
GAAGGGGGACAAAAAGAAGAAGCGGAAGAGTGGTGGTACTGCGCCTGATGAATCTCGTTCTAAGAAATCATCAGTTAGGG
ACTCTGATGAATACTATTCGAAGCCTGTCAAGGATTATTACTTGGACACTCGTCCTGATCCAGATAATCTGGTTTATGGT
TCCATCTACAGGATGAATGTTCCTCGTTATAAACTTGACAATTCTCAAAGAGTTTCTGGGACAGGTTCTCTGAGGTTTTA
TTTGCGGAATCGGCGTAGTTCTATGCTTGACACAGAGATTGATATTGATTCTTTGGAGGGAAGAGCTAAGTCTGATACCC
GATATTGGTATGCAAAACATGCTGCCATGGAACGCAACAAGAATTTCAAGCGGATTCGTTTATCTGCTTCAAGGGAAGCT
GTGGATTCCAACTTTGATCATTTCATTCCACTGGAGGAAGGTGAGGCTGTTCAAGAAAGTGACGAGGAAGATGTTCTATC
AAAGGACTCAACGATGGGAGCATCATGGGAGGATGACGTGCTGGATAAAACGCGAGAGTTTAACAAAATGACGAGGGAGC
GTCCCCATGATGAAAAGGCATGGCTAGCATTTGCTAACTTTCAAGACAAGGTTTCAAGTATGCAATCTCAGAAAGGAGTT
CGCCTGCAGACTTTAGAGAAGAAGATTAGTATACTTGAGAAGGCTTTTGAACTTAATCCAGATAGTGAAGAACTGTTGCT
TGCACTTCTCAAGGCATACCGAAGCAGAGACAACGCCGATGCATTAATCAGCAGGTGGGAAAAGGCACTTATGCAGAATT
CCGCTAGCTACAAGTTATGGAGGGAGTTTTTATGTGTTGTTCAAGGGGAGTTCTCCAGATTCAAAGTTTCGGAAGTGAGG
AAAATGTACTCTTATGCAATCCAGGCTCTTTCTTCTGCTTGCAACAAGCGCCATAGGCAGGTGGATACAACATCTGAACC
ATTGGATTCTGCTGCCATCCAGCAGGAACTCGTTCTAGTCGATATGCTAGTTAGTCTCTGCAGGTTTGAATGGCAGGCTG
GTTACCAGGAGTTGGCCACAGCGTTATTTCAAGCTGAACTGGAATTTAGCATCTTTTGTCCATCTTTGTTGCTTACTGAA
CAAAGTAAATTAAGACTGTTTGAGCACTTTTGGAGCAGTAATGGTGCTCGAGTTGGAGAAGAAGGAGCTTTTGGATGGTC
ACTGTGGCTGGAGAAAGAGGAGGAAAACAGGCATAAGATTCTGAAAGAAGAATCCTCTGATGACAATGACGTAGGTGGTT
GGACAGGTTGGACAGAACAGGTCTCAGGTAGAAATGGAGATAGTATTGCTTCCGCTAACACTGTAGAGGTTGATGTTGCT
CGAGAGAGTCTGGATGAGGAAATGGATGACGAAAATAGCAAACCTGAAGATGATACTGAAGCTATGCTAAAATCATTGGG
CATTAATGTCAATGCAGCGGCCAGTGATGAGGTCAAAGATACATCAACTTGGGTTAAATGGTTTGAAGAAGAGGTTTCTC
GAGATCTCAGTCAATGGATGCCTACTCGGAAAGCTGGTGAATTCTCCAGTGTTGATGAAATGGGCGAGGGAGAAGATGAA
GAGCAACTTTCAAGTGTTGTACTATATGAAGATATAAATGGATATCTATTTTCCTTACGTTCAGATGAGGCCCGACTATC
TCTGGTATACCAGTTTATTGATTTCTTCGGTGCACATATTCCTCCATGGACTTCTAGCAACAGTTTGTCGTGGAGTGAGA
AAATAAGTAGCCTTGAAACATTGTCAGATTCTATGTTAGAAAACTTGAGAAGTGTACATGAATGTTTGTCGAAATCAGAT
AGCACCAACGGTTTCAGCTTGGGATCTCTTTTAGGTGGCAGCTGCGACATATCTATGCGGACTGAGATGATGAAGTTTCT
CCGTAATGCCATCTTACTTTGTCTAAATGTTTTTCCGCGAAACTACATTCTGGAAGAAGCTGTCCTTGTTGCAGAAGAGC
TTTTTGTAACAAATATGAATACATGTGACGCAGCAACTACTCCATGCCAAGCTTTGGCCAAACGTCTCTTGAAAAGTGAC
CGGCAGGATCTACTACTCTGTGGAGTTTATGCACAGCGAGAAGCTGCTTCTGGAAATATGAAACATGCAAGACGAGTCTT
TGACATGGCACTGACTTCTATCTGTGGCCTCCCTAAGGAATTACAGTATAACGCTTCGTTGCTATGTTTATGGTATGCTG
AATCAGAAATAGCAAATAGTAGCCTCAGAGCTAAGGATACAGAATCATCATCTCGTGCTATGCACATTTTGTGCTACCTG
GGAAGTGGTCTAGCTTATGTTCCTTATACTTCCCAGTCTTCAAGCATGCAAATCCTTAGAGCACGCCAAGGGTTCAGAGA
GAAGCTTAAGAAGATACAATCCGCATGGTCTCATGGTGTCACTGATGATCAATCAGCAGCTCTTGTTAGTTCGGCAGCTC
TATTTGAGGAGTTAACAAATGATCTTTCTGCCGCTGTTGAGATCCTAGAGCACATGTTCAGTTCTGTTCTTCCAGGAAGA
AAAAGTCAAAGCCATCAACTCGAGCTCTTGTTCAATTATTATGTGAGAATGCTTCAGAGACACCAGGACGATCTAACTTT
GTCACAACTTTGGAAGCCCATATCAGAAGGACTGCAGCAGTATCCTCTCAATCCGGAGCTTTATCGAGCTTTGGTGGACA
TCTGTAATCGCCGTATGACATCCCATAGACTGAGAATGATGTTTGATGACTACTCCCGCAAGAGTTCATCTGCCGTTGTT
TGGCTATTTGCACTTTCTTATGAGTTGAGTAAAGGAGGGTCCTCACACAGAATCCGTGGATTGTTTGAAAGGGCATTTGC
ACAAGATACACTAAAAAACTCGGTCATTCTATGGCGTTGCTACATTGCATATGAGATGGACATCGCACACAATCCATCAG
CAGCTAGAAGGATATACTTCAGAGCTATAAATGCATGCCCATGGTCGAAAAAACTATGGCTGGATGGGTTTAGGAAGCTG
AGCTCAGTCCTTACGGTGAAAGAGATGTCAGATTTACAAGAAGTGATGCGGGACAAGGAACTGAACATTAGGACAGATAT
CTACGAGATTCTTCTTATGCAGGGATGA