Details for Capsella Locus Carubv10012838m

Position : scaf_3 ( 5`- 5152670 .. 5158994 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012838m

Protein [Map View]
MMLGGAEIEMFGGDCFEGSYEDHKIFREVFFGTDPENTTKRCLVTGVINFECDSTKNVNSSLSSNNDNSVITSGYLEGFE
ASASKDGSDFNNRAKRVKLSGNKHLDVRDEKGSALNGFPNSDIARETVPLHLVESSNSGVLTSSYLLKQSIEKGREVYLG
GIVSERFKSQNLDRSDGKEFKAIASPVSQESFATRMICAGASTPHSEKQAFSLQLNNGSKVSPNELVMSQTCLKIDPKED
PRPLLYKYACKLLNAARWKIEKRARSGRKYLETFYISPEGRRFREFGSAWKSLGRILLADHKLMDTSTKKWTGINDFWSD
LSLTLLDIEENMKNINLANTRALWWSALEPFVIAVFISKQVGSLRRGNKVEVARNTVIDKFKKDDATCLNMISGCPESVL
TLSEGSHLVCDVDASQEIHSDLEVQTKIVRRKVSTGLERQNIIGKEISGADEQEVSKGVVASKLIAEDMLESVMRKKLHR
RSKKISDIKLAPLDQHDSLDSNSLDNLEGQDKEMGSIHLISKRSRDERLRNEKMKNSFCNSKKGRKKARKHYSQDDDLMV
SSVIRKKGKVWRSSQKKKTHKPKARTKKRNNKGGCRLLPRSTSNAENQNFQGNWSILGPRTVLSWLIATKVISRDEVIQL
RDPDDDTVVKTGLVTKDGVVCTCCNRTVSLSEFKNHAGFNQNCPCLNLFMGSGKPFASCQLEAWSAEYRARRTGWRSVEA
SDDDPNDDSCGVCGDGGELICCDNCPSTFHQACLSMQMLPEGSWYCSSCTCWICSELVSDNAERSQDFKCSQCAHKYHGI
CLQGASKRRKLFPETYFCGKGCEKVYTGLSSRVGVINPSADGLSWSILKCFQEDGSVHSARRIALKAECNSKLAVALSIM
EESFQSMVDPRTGIDMIPHVLYNWGSKFARLDFDGFYTVVVEKDDVMISVASIRVHGVTIAEMPLVATCSKYRRQGMCRI
LVAAIEEILMSLKVEKLVVAALPSLVDTWTQGFGFKPMDDEERDALNRINLMVFPGTILLKKTLYESTNTNTVKGVCLSE
DHSKPSNKEADVEPGVDKAGFPMNTQIESCDQMVPAGSDEEPAPGFPVPLGAKETEPTSETENRSGESNADDRPNKTTIS
MGEEEGLQEEVSKFSEEGKEMARASSTSAALEEVSDVGVVVVNNVSDDMLLCFDEQLDSDSSEEEENSE*

DNA
ATGATGCTTGGCGGAGCTGAGATTGAGATGTTTGGAGGTGACTGCTTTGAAGGGTCATATGAGGATCATAAGATATTCAG
AGAAGTTTTCTTTGGAACTGATCCTGAAAATACTACTAAAAGATGCCTGGTTACTGGAGTCATTAACTTCGAGTGTGATT
CCACTAAGAATGTCAATTCCTCTCTGAGTTCCAACAATGACAATTCTGTGATAACAAGTGGATATCTAGAAGGTTTTGAG
GCATCTGCTTCAAAAGATGGTTCAGACTTTAACAACAGAGCTAAGAGAGTGAAGCTTTCCGGTAATAAGCATTTGGATGT
GAGGGACGAAAAGGGGTCGGCTTTGAATGGTTTTCCAAATTCGGATATTGCTAGAGAAACAGTACCTCTTCATTTAGTTG
AATCATCTAATAGTGGTGTTTTAACTAGCTCATATTTGCTAAAGCAAAGCATAGAAAAAGGAAGAGAAGTTTATCTGGGT
GGCATTGTCTCAGAAAGATTCAAGTCACAAAACTTGGACAGGTCCGATGGAAAGGAATTTAAAGCAATTGCCTCTCCTGT
TTCTCAGGAGAGCTTCGCAACCAGAATGATCTGTGCAGGTGCTTCTACTCCTCATAGTGAGAAACAAGCCTTCTCACTGC
AGCTGAACAATGGATCTAAAGTATCTCCTAATGAGTTAGTTATGTCTCAAACCTGTCTAAAGATTGATCCTAAAGAGGAT
CCCCGTCCTCTTCTCTACAAATATGCCTGTAAGTTGCTAAATGCTGCCAGATGGAAGATCGAGAAGCGCGCAAGATCAGG
TAGGAAATACCTAGAAACTTTTTACATATCGCCAGAGGGACGGAGATTTCGTGAATTTGGGTCAGCTTGGAAATCGTTGG
GTCGGATCCTATTAGCTGATCATAAGTTAATGGATACTAGTACTAAGAAATGGACCGGTATCAATGACTTCTGGTCTGAT
CTCTCTCTTACACTGCTGGACATCGAGGAGAACATGAAAAATATAAATCTTGCTAACACACGGGCACTTTGGTGGAGTGC
CTTAGAGCCTTTTGTGATTGCTGTCTTCATTTCTAAGCAAGTTGGATCTTTAAGAAGAGGAAATAAAGTCGAAGTTGCAA
GGAATACAGTTATTGATAAGTTCAAGAAAGATGATGCAACTTGTTTGAACATGATTTCAGGCTGTCCTGAAAGTGTGCTG
ACTTTATCTGAAGGTAGCCATCTTGTTTGTGACGTGGATGCTAGCCAAGAGATTCATTCAGATCTTGAGGTGCAAACTAA
AATTGTCCGTCGAAAGGTTTCTACAGGACTAGAGAGGCAGAACATAATTGGTAAGGAAATCTCTGGGGCTGATGAGCAGG
AGGTTAGCAAGGGAGTTGTAGCTTCAAAATTGATAGCAGAAGACATGCTTGAAAGTGTGATGAGAAAGAAGTTACACAGA
AGATCCAAAAAAATATCGGACATCAAACTAGCTCCCTTGGACCAACATGATTCACTAGATTCTAATTCCCTCGACAACCT
TGAAGGCCAGGATAAAGAGATGGGCAGCATTCATCTCATCTCAAAGAGAAGTCGGGATGAAAGGTTGAGGAATGAGAAGA
TGAAGAATTCATTTTGCAATTCAAAGAAAGGAAGAAAGAAAGCTAGGAAGCACTATTCTCAAGATGATGACCTTATGGTG
TCGTCAGTAATCAGAAAGAAAGGTAAGGTTTGGAGATCAAGCCAGAAAAAGAAAACCCATAAACCAAAGGCTAGAACAAA
AAAAAGAAACAATAAAGGAGGGTGCAGGCTGCTTCCCCGAAGCACAAGCAATGCGGAAAATCAAAATTTTCAAGGAAATT
GGTCTATTTTGGGTCCAAGAACTGTCTTATCATGGTTGATAGCTACCAAAGTAATTTCTAGGGACGAAGTAATCCAGTTA
CGAGATCCAGATGATGATACTGTGGTAAAAACAGGCCTGGTAACTAAAGATGGAGTGGTTTGTACATGTTGCAACAGGAC
TGTATCACTTTCTGAATTCAAGAACCATGCTGGATTTAATCAGAACTGTCCATGTCTGAATCTTTTCATGGGGTCGGGAA
AGCCTTTCGCTTCATGTCAGCTGGAAGCTTGGTCTGCTGAGTATAGGGCGCGAAGAACTGGATGGAGATCAGTGGAAGCT
TCTGACGATGATCCAAATGATGATTCTTGTGGAGTTTGTGGTGATGGAGGTGAGCTGATCTGCTGTGATAATTGTCCATC
GACCTTCCATCAGGCTTGCTTATCAATGCAGATGCTCCCTGAAGGAAGTTGGTATTGCTCGAGCTGCACATGTTGGATAT
GCAGCGAGTTGGTCAGTGATAATGCTGAACGCTCTCAGGATTTCAAATGTTCCCAATGTGCGCATAAATATCATGGAATA
TGTTTGCAAGGGGCAAGTAAACGGAGAAAACTTTTTCCAGAAACCTACTTCTGTGGTAAAGGTTGCGAGAAGGTGTACAC
TGGTCTCAGTTCTCGTGTCGGGGTCATTAACCCTAGTGCTGATGGTCTGTCTTGGTCAATTCTGAAATGTTTTCAAGAAG
ATGGGAGTGTTCATTCTGCCCGAAGAATAGCGCTGAAGGCTGAATGCAACTCGAAGTTAGCTGTTGCCTTATCAATTATG
GAGGAAAGCTTTCAGTCTATGGTAGATCCAAGAACTGGTATTGACATGATACCTCATGTGCTATACAACTGGGGGTCAAA
ATTTGCTCGCTTAGACTTTGATGGGTTTTACACAGTGGTTGTGGAGAAGGACGATGTGATGATCTCAGTAGCATCTATCA
GGGTGCATGGAGTAACTATTGCAGAGATGCCTCTTGTAGCTACTTGCAGCAAATATCGCCGACAGGGGATGTGCAGAATA
CTTGTGGCTGCCATCGAAGAGATACTTATGTCTCTCAAAGTGGAGAAGCTTGTGGTAGCTGCATTGCCGAGTTTAGTGGA
TACTTGGACCCAAGGTTTTGGCTTTAAACCCATGGATGATGAAGAACGTGATGCTCTCAATAGAATAAACTTGATGGTCT
TCCCTGGGACAATTCTGCTCAAGAAAACGCTCTACGAGAGCACAAACACCAACACTGTGAAAGGCGTTTGTCTTTCTGAA
GATCACAGTAAACCATCAAACAAAGAAGCAGATGTAGAGCCAGGCGTAGACAAAGCTGGTTTTCCCATGAATACCCAAAT
AGAGAGCTGTGATCAGATGGTTCCAGCAGGTTCTGATGAAGAGCCGGCCCCAGGCTTCCCCGTGCCACTTGGAGCCAAGG
AAACAGAACCAACTTCAGAAACAGAGAACCGAAGCGGAGAGAGCAATGCAGATGATAGGCCAAATAAAACAACAATATCT
ATGGGAGAAGAAGAAGGTTTGCAGGAAGAGGTATCAAAGTTTTCAGAAGAAGGAAAAGAAATGGCAAGAGCTTCTTCTAC
CTCTGCAGCTTTAGAAGAAGTAAGTGATGTAGGAGTAGTAGTAGTAAATAATGTTAGTGATGACATGTTGCTTTGTTTCG
ATGAACAGCTTGACTCTGATAGCTCTGAAGAAGAAGAAAACTCGGAATAG