Details for Capsella Locus Carubv10012837m

Position : scaf_3 ( 5`- 6032133 .. 6040630 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012837m

Protein [Map View]
MAGGIKTEIPVTIMNRRVIGTVEECENGVVRRSNKRVLYIRQFEIVMRLKNRASRHGRIEDYHSFLLVIDALDLVATGRS
VNKEISLEKNNNEKAISKKKNTHKMFVGDDDSIQIVRLLEQTLTSIDGVAVREATEALDRLATELPHFPYRLLSIASGGE
NPSQRVAAATYLKNFTRRSTGIEGTISEVSKEFKDQLLLALLQAEPAVLKVLLELLHIVVVSEFVKKNAWPELVPELRSA
IEKSSLISSSNSSWSTVNALLVLLTVVKPFQYFLQPKLAKEPVPQQLESITKEILVPLVSVLHRFTEKALTTKGLGELEL
EKTLHIICKCLYFSVKSHMSSALSPLLSSFSRDMIRILDSLSFDWSVTPSDGNLMRLKAGKRSLLLFGTLVSRHRKYSDK
LVPEIVNCSMNIIKHSSNISRLGCLTERIISLAFDVISRVMEIGPGWRLLSPHFSTLLDSAIFPALVLNERDISEWEEDA
DEFIRKNFPSELEEISGWREDLFTARKSAMNLLGVLAMSKGPPVSTTNKASSAACKRKKGEKSRRNNQRCMGDLLVLPFL
SKFPVPLKSYILDASTPAAYFGVLMAYGSLQEFIQEQNPEYVASFVRTRVLPIYSTPDVTPYLVASANWVLGELASCLPE
EMNADIFSSLLKALAMPDQVEISCYPVRVSAAGGIGSLLENEYQPPEWLPLLQIIIGRVGSEEDEDGILFQLLRSVIDSG
SQDISTHIPYIVSSLVSNMLPFLHPSEDPWSQAILGGLETLAVMAQTYESSKPAANEENNQATGIWVTGQGTISRALSSI
LHHAWLTTDVPPTSCVDHLSMMLRFIVIASTNCNELRLTELLVVWADILASWNGWEESEDLSIFDCIEEVVGINNKYGFR
SFLFRDMPSPPAMPVRPQSVAESIGSFVSKAILEYPSARRRACSCVHTLLHVPDYSSDIEGVGKSLAMVFSEAAFSRFLG
LREKPCTLWRPLLLVISSCYISYSDVVEIALEKVISGGFELWASSLAFSYSLTFDATPALASEIKLYVMTLVKVIEQLLD
VKHGNATDDLARKCFVSLVEASQRLKELNEETDDDEDDGEPGEEETESEETDSNDEDSESDECEETEEEFLERYAKTAAE
LENSEVTEEEDEEDDEHEIDLGSLNEIDPQKLVLSLMEKHHEKVIKLVPSEVISTFLNSFPVFTSLFSKCL*

DNA
ATGGCCGGCGGCATTAAAACAGAGATTCCGGTAACGATTATGAACCGGAGAGTCATCGGAACAGTTGAGGAGTGCGAAAA
CGGTGTCGTACGAAGGTCTAATAAGCGCGTTCTGTATATCCGCCAATTTGAAATCGTGATGAGGCTGAAGAATCGAGCAA
GTAGACATGGACGGATCGAAGATTACCATAGTTTTCTTCTCGTAATCGATGCTCTTGACCTTGTAGCTACCGGAAGGAGT
GTAAATAAAGAAATAAGCTTGGAGAAAAATAATAATGAAAAAGCAATAAGCAAAAAAAAAAACACACACAAAATGTTCGT
CGGCGACGACGACTCAATTCAGATTGTTCGACTTCTTGAGCAGACGCTTACTTCCATAGATGGCGTTGCAGTCCGCGAGG
CGACGGAGGCTCTGGATCGACTTGCTACAGAGCTCCCTCACTTCCCTTATCGTCTTCTTTCCATCGCTTCCGGAGGAGAA
AATCCCAGCCAGAGAGTTGCCGCTGCAACATATCTTAAGAATTTTACCAGAAGGAGCACTGGGATTGAAGGGACAATCTC
TGAAGTCAGCAAGGAGTTTAAGGATCAGCTCCTCCTAGCTTTGCTTCAGGCTGAGCCAGCAGTTCTTAAAGTTTTACTTG
AGCTGCTCCACATTGTTGTTGTATCAGAATTTGTGAAGAAAAATGCATGGCCTGAACTTGTACCTGAGCTGCGCTCTGCT
ATCGAGAAGAGCAGCTTGATTAGCAGTTCAAACTCTAGCTGGAGTACTGTGAATGCTCTGCTGGTATTGCTTACAGTTGT
AAAGCCATTTCAGTACTTCCTTCAACCAAAACTTGCAAAGGAACCAGTACCACAACAGCTGGAGAGTATCACGAAAGAAA
TTTTAGTACCCTTGGTGTCAGTACTGCATCGTTTTACTGAGAAGGCTTTGACTACAAAGGGATTAGGTGAACTGGAATTG
GAAAAGACACTCCACATTATCTGCAAATGCCTATACTTTTCAGTGAAGTCCCATATGTCATCAGCTTTGTCACCTCTGCT
CAGTTCCTTCTCTCGAGATATGATCAGAATTCTGGACTCCTTGAGTTTTGACTGGAGTGTCACTCCTTCAGATGGGAACT
TGATGAGGTTGAAAGCTGGAAAAAGAAGTTTGCTCCTCTTTGGCACACTTGTCAGCAGACATAGAAAATACTCTGACAAA
TTGGTGCCGGAGATAGTAAACTGCTCAATGAACATTATCAAACATAGTTCCAATATCAGTAGGCTCGGATGTCTAACTGA
GAGAATTATATCACTTGCTTTTGATGTAATTTCACGCGTCATGGAAATTGGCCCTGGATGGAGATTACTTTCACCCCATT
TTTCTACTTTGTTGGATTCTGCAATCTTTCCAGCACTGGTGCTGAATGAGAGGGACATATCTGAGTGGGAAGAAGATGCA
GATGAATTCATAAGGAAAAACTTTCCATCTGAACTAGAAGAGATTTCTGGGTGGAGGGAAGACTTGTTTACAGCCAGGAA
AAGTGCCATGAACTTACTTGGTGTCCTTGCCATGTCAAAGGGACCACCAGTATCTACTACAAATAAAGCATCCTCAGCTG
CATGTAAGCGGAAGAAAGGTGAAAAGAGCAGAAGAAATAACCAAAGATGTATGGGAGATCTACTGGTGCTTCCATTTTTG
TCAAAGTTTCCGGTGCCTTTGAAAAGTTACATACTGGATGCTAGTACTCCAGCAGCCTATTTTGGTGTCCTAATGGCATA
TGGTAGCCTGCAAGAGTTTATCCAAGAACAAAATCCTGAGTATGTGGCATCTTTTGTCCGTACTCGTGTGCTACCGATTT
ATTCTACACCTGATGTCACACCTTACCTGGTTGCATCAGCAAATTGGGTACTTGGAGAGCTTGCGTCCTGCCTACCTGAG
GAGATGAATGCAGATATTTTTTCTTCCCTACTGAAGGCATTAGCAATGCCAGATCAGGTGGAGATCTCTTGTTACCCAGT
GCGTGTTTCAGCTGCTGGTGGGATAGGTTCACTACTCGAAAATGAGTACCAACCACCTGAATGGCTGCCGCTTCTTCAAA
TTATTATTGGTAGGGTTGGTAGTGAGGAGGACGAGGATGGCATTTTGTTTCAGCTTCTCAGATCTGTGATCGATTCGGGA
AGTCAAGATATTTCCACACATATTCCGTACATTGTCTCTTCGCTAGTTAGTAATATGTTGCCGTTTCTGCATCCTAGTGA
AGATCCATGGTCTCAGGCTATTCTAGGTGGCCTGGAGACATTAGCAGTAATGGCTCAGACTTATGAGAGCTCTAAGCCTG
CAGCGAATGAAGAGAATAATCAGGCGACTGGAATATGGGTAACTGGTCAAGGCACAATCAGCAGAGCTTTGTCATCAATT
TTACATCACGCATGGCTGACAACAGATGTGCCTCCGACTTCATGCGTAGATCATTTGTCGATGATGTTGCGGTTCATTGT
GATTGCTTCCACTAATTGCAATGAGCTCAGATTAACTGAATTACTCGTAGTTTGGGCTGATATTCTTGCTAGCTGGAATG
GTTGGGAAGAGTCGGAGGACTTATCAATTTTTGACTGCATAGAAGAAGTTGTGGGTATAAACAACAAATATGGTTTTAGG
AGTTTCCTTTTCAGAGATATGCCATCTCCGCCAGCCATGCCAGTCCGTCCACAATCTGTTGCTGAATCCATTGGTTCATT
TGTCAGCAAAGCCATACTTGAGTATCCGTCTGCCAGAAGGAGGGCTTGTTCTTGTGTCCACACGTTATTACATGTACCAG
ACTACTCTTCTGACATCGAAGGGGTGGGAAAATCATTGGCAATGGTCTTCAGTGAAGCAGCCTTTTCCCGTTTTTTAGGG
TTGCGCGAGAAACCTTGTACTTTGTGGAGGCCTCTATTACTGGTAATATCGTCATGCTATATCTCCTATTCCGATGTTGT
GGAAATTGCTTTAGAGAAAGTGATATCTGGAGGTTTTGAGCTATGGGCATCTTCATTGGCATTTTCATACTCACTTACGT
TTGATGCCACTCCAGCATTAGCATCGGAAATAAAACTATATGTGATGACGCTAGTAAAGGTGATCGAGCAGCTTTTAGAT
GTAAAGCATGGGAATGCAACTGATGATTTGGCAAGGAAGTGCTTTGTTTCATTGGTGGAGGCTTCTCAGAGGCTAAAAGA
ATTGAATGAAGAAACAGACGATGATGAAGATGATGGAGAACCTGGAGAAGAAGAGACAGAATCTGAAGAAACTGATTCAA
ATGACGAGGATTCCGAGAGCGATGAGTGTGAAGAAACAGAGGAAGAATTTCTGGAAAGGTATGCTAAAACTGCAGCAGAG
TTGGAGAATAGTGAAGTAACCGAAGAGGAAGATGAAGAAGATGATGAACATGAGATTGATTTGGGTTCTCTGAATGAAAT
TGATCCGCAGAAACTGGTTTTATCATTAATGGAGAAGCATCACGAGAAAGTAATCAAACTCGTACCCTCAGAAGTTATCT
CAACTTTTCTCAATTCTTTTCCTGTGTTCACAAGTCTCTTCTCTAAGTGCCTCTAA