Details for Capsella Locus Carubv10012836m

Position : scaf_3 ( 5`- 7689350 .. 7695300 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012836m

Protein [Map View]
MYRESSKRGGRGGGGGGGGGPSRNRNSFPPPTNRHPSPVGRMSSGGSAVSRQRNNTTSVKAAASTASVRSVEETFSLVPR
ESPSAFGMIIRLAPDLVEEIKRVEAQGGAAKIKFDAFPNNSTGNIINVGGKEFKFTWSRERGDLCDIYEEHQSDEDGNGL
LIEAGCAWRKLNVQRTLDESTTSHMKMRSVEAEQRTKSRKAIVLDPGNPSVTKQLALAEGSPWRMSNKQKKEPPPKKRKV
DPPPVPIGGPKPSFRPGASTPAVKNRLSASPGPSPINQNNTPPSYEIGNITKTHAANENVTPVLTKGRENMLGSEKESST
WKNNALRDTSERQATNVNEEIDLQTLLVDILKEAPMSSKALEKAVGDRIPNAAKKIQPILKKIATFQAPRYFLKPEAELG
SDKKHSPNSGSSPEHQQVLPITECSRDQLPVPGGNNMEKLSVYERNGEGSLDCLPLHLAEQLSMLNVDNEHHSPGIFHEE
KGSDNREGQARSSSDSDSDSDNSDSGSDSKSAAGSDSGSSSDSEASSNSKDGSDEDVDIMGDGDREPLLTIQSAERGAIN
LPGHGSSAVEIEGHDSDAVDIEGHDSDAVDIDGHGSDAVDVEGNSSDEGHGSETDRNKISDNNWRTETTTGTSLTANEEV
GISGQEHFASGHDKLRERQDFIGQLFDDTENTTKDNFKSDKPDISESLTKDQNQKALDLEHYSQISAREKKLKSQSCKQL
PAIGKDSQRSELKYDAELRNSSASQTIDPLRGSQKSFIEKSNRHGQMKPVDSSGKSNKHSDALGYVRKSDEGDHFPHEML
SGRSGKAFRDSQRDDVHLKNKFPRNKKDGDSAIRPSLPTETSDRKHFELDGSEKDPKNVSSLSIVSSPLDSQRIHGAKLP
KGNGSVLQKQVSELELGELPEPSSEDTALKPLEEKTSFRQSNLKPSTSEKLGIDSDRRRSKKSDSKKSAPPHAINGIKEF
PEHVVEDSERSQKWVSQSHGQNLTGRDNETGSQNTNLEDAAYKSRQKDSRARVGSSVEGYGETNKKTPVIKHGSKRASTS
RSSRESKRHASGSISNSMNGHKDATSIPGDSVVREKRMTSFDEEDSSYLKYEKASPELKGPISDHLQYKAYMQEYMEKYD
SYCSINNILEGHRNDFQKLGQDLEFAKGRDVERYNKIVEQIQESYCKYGEMNFQRHIKFGCRRKFGDRPLIEKG*

DNA
ATGTACAGAGAATCGTCCAAGCGTGGTGGTAGAGGAGGAGGAGGAGGCGGTGGCGGGGGACCTTCTCGTAACCGTAATTC
ATTCCCTCCTCCTACTAACCGACATCCTTCTCCCGTCGGGAGGATGTCTTCTGGTGGCTCCGCCGTCTCACGCCAGCGGA
ATAATACTACGAGCGTTAAGGCGGCTGCGTCGACCGCGTCTGTTCGGTCTGTTGAGGAAACGTTTAGTCTTGTTCCTAGG
GAGAGTCCTTCGGCTTTTGGGATGATTATACGGTTAGCTCCTGATTTGGTGGAGGAGATCAAGCGTGTTGAGGCACAAGG
TGGAGCTGCCAAGATCAAGTTCGATGCGTTTCCTAACAATAGCACTGGGAATATAATTAATGTTGGTGGAAAGGAGTTCA
AATTTACTTGGTCTAGGGAGCGTGGTGACTTGTGTGATATATATGAAGAACATCAAAGTGATGAAGATGGAAATGGTTTG
CTGATTGAGGCTGGATGTGCTTGGCGAAAATTGAATGTCCAGCGAACTCTAGATGAGTCAACCACAAGCCATATGAAGAT
GCGCTCAGTTGAAGCTGAGCAGAGAACCAAATCACGCAAGGCAATTGTTTTAGATCCTGGGAATCCATCAGTAACTAAGC
AGTTAGCTCTTGCTGAAGGAAGTCCATGGAGAATGTCAAATAAACAGAAGAAGGAACCTCCGCCTAAGAAGCGGAAAGTT
GATCCACCTCCAGTTCCAATCGGAGGTCCGAAGCCTTCTTTCAGACCAGGGGCTTCTACCCCTGCTGTGAAAAATAGGCT
ATCAGCTTCACCGGGACCGTCTCCTATTAATCAAAACAATACGCCTCCTTCATATGAGATTGGGAATATTACTAAAACTC
ATGCAGCTAACGAGAATGTCACACCAGTCCTGACAAAGGGCAGAGAGAACATGCTTGGTAGCGAAAAAGAATCATCAACC
TGGAAAAATAATGCATTAAGGGACACATCTGAGCGCCAAGCAACCAATGTTAATGAAGAAATTGACTTGCAGACCCTGTT
GGTTGATATCCTAAAAGAGGCTCCCATGAGTTCGAAGGCTTTGGAGAAAGCTGTTGGAGATAGAATCCCTAATGCTGCAA
AGAAAATTCAACCAATTTTGAAAAAAATCGCTACTTTCCAAGCTCCAAGGTATTTCTTAAAACCAGAAGCAGAGTTGGGA
AGTGATAAAAAACACTCACCTAACAGTGGAAGTTCACCTGAACACCAGCAAGTGCTACCAATCACTGAGTGCAGTCGCGA
TCAGTTACCTGTTCCAGGGGGAAATAACATGGAGAAACTTTCTGTGTACGAGCGAAACGGAGAAGGTTCACTAGACTGTT
TACCTTTGCATCTAGCAGAGCAATTGAGTATGCTCAATGTTGACAATGAGCATCATTCACCTGGTATATTTCATGAAGAA
AAAGGATCTGACAATAGAGAAGGCCAGGCTCGTAGCTCTAGTGATAGTGACAGTGATAGTGATAACAGTGACAGTGGGAG
TGACAGTAAAAGTGCAGCTGGAAGTGACAGTGGGAGCAGCAGTGACAGTGAGGCTTCTTCCAACAGTAAGGACGGTTCTG
ATGAGGACGTGGATATCATGGGTGATGGTGACAGAGAGCCTCTACTGACAATACAGTCCGCTGAACGGGGTGCAATTAAT
CTCCCAGGTCATGGTTCTAGTGCTGTTGAAATCGAGGGTCATGATTCTGATGCTGTCGACATTGAAGGTCATGATTCTGA
TGCAGTTGACATCGATGGTCATGGGTCTGATGCAGTTGATGTCGAGGGGAACAGTTCAGATGAGGGTCATGGCTCTGAAA
CTGACAGAAACAAAATTTCTGATAATAATTGGAGAACGGAAACAACAACTGGTACCAGCCTCACTGCAAATGAAGAAGTT
GGCATTTCAGGGCAGGAACATTTTGCTTCTGGTCATGACAAGCTACGAGAGCGCCAAGATTTTATTGGACAGTTGTTTGA
TGACACAGAGAATACAACAAAGGATAACTTTAAAAGTGACAAACCTGACATCTCCGAGAGTCTGACAAAAGACCAGAACC
AAAAAGCCCTTGATCTTGAGCACTACAGTCAGATATCAGCTCGGGAGAAAAAGTTAAAATCCCAGAGCTGTAAACAGTTA
CCTGCCATAGGTAAAGATTCACAGCGTTCAGAGCTAAAGTATGATGCAGAACTTCGCAACTCTTCTGCCAGTCAAACAAT
AGATCCACTTAGAGGATCTCAGAAGTCATTTATTGAAAAGTCGAATAGACATGGTCAAATGAAGCCTGTTGATAGTTCAG
GTAAATCAAACAAACATTCTGATGCCTTAGGATATGTTCGTAAATCTGACGAAGGGGACCATTTTCCTCATGAAATGCTT
TCTGGTCGGTCAGGAAAGGCCTTCAGGGACAGCCAAAGAGATGATGTTCATTTGAAAAATAAGTTTCCAAGGAATAAAAA
AGATGGTGATTCAGCCATTCGACCTTCATTACCTACCGAGACATCTGATAGAAAACACTTTGAACTGGATGGAAGTGAAA
AGGATCCCAAGAATGTTTCAAGCTTGAGCATAGTTTCTTCTCCCTTAGATAGCCAGAGAATACATGGGGCGAAATTACCT
AAGGGAAATGGATCTGTCCTCCAAAAACAAGTTTCCGAATTGGAGTTGGGTGAACTCCCTGAGCCATCGAGCGAAGATAC
AGCATTGAAGCCACTCGAAGAGAAAACTTCGTTTAGGCAGTCAAATTTAAAACCAAGCACTTCCGAGAAATTGGGTATCG
ACTCGGATAGACGAAGGTCTAAAAAATCTGACTCAAAAAAGTCAGCTCCTCCACATGCTATCAACGGTATCAAAGAATTT
CCCGAACATGTTGTTGAAGATTCAGAAAGATCCCAAAAGTGGGTTTCGCAGTCACATGGGCAGAACCTTACAGGTAGGGA
TAATGAAACCGGCTCACAGAACACAAATTTAGAGGATGCAGCTTATAAATCAAGACAAAAAGATAGTAGAGCTAGAGTAG
GAAGCAGTGTGGAAGGTTATGGAGAGACAAACAAAAAAACGCCTGTTATAAAGCATGGCTCCAAACGAGCATCCACATCC
CGCTCATCAAGGGAGAGCAAAAGACATGCGTCTGGCTCAATTTCAAATTCTATGAATGGACACAAAGATGCAACTTCAAT
ACCAGGTGACAGTGTTGTCCGGGAGAAACGAATGACATCTTTCGATGAAGAAGACTCTTCTTATTTGAAATACGAGAAAG
CTTCTCCTGAGCTTAAGGGACCTATTAGTGATCATTTACAGTATAAAGCCTATATGCAGGAATATATGGAAAAATATGAT
AGCTATTGCTCCATTAACAATATATTAGAGGGCCACAGAAATGACTTTCAGAAGTTGGGGCAAGACCTTGAGTTTGCAAA
AGGAAGAGATGTGGAGAGATATAACAAAATTGTGGAGCAGATACAGGAATCTTATTGCAAATATGGGGAGATGAATTTCC
AGCGTCATATAAAATTTGGATGTAGAAGGAAATTTGGAGACAGACCTCTCATTGAAAAAGGATGA