Details for Capsella Locus Carubv10012835m

Position : scaf_3 ( 5`- 13530462 .. 13535713 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012835m

Protein [Map View]
MRGDSFSMSIENLPDSPMGSRRKKMKIRKVFDKMTELVAPWRSNLESPRERMILRGDVEQDEFQYASSHCLSSYYSVFVV
RLAIMVMLAILIGLLTVLTWHFTRIYTKQSLQNLAYGLRYELLQRPVLRMWSVLNTTSELTTAQVKLSEYVIKKYDKPTT
QEELVEMYQAMKDVTWALFASAKALNAITINYRNGFVQAFHRDPASSSTFYIFSDLKNYSISGTGPEDVSGWNNQSIHGN
MSAIWYQQQLDPITGEKLGKPLKIPPDDLINIAGISQVPDGEASWHVTVSKYMDSPLLSAALPVFDASNRSIVAVVGVTT
ALYSVGQLMRDLVEVHGGHIYLTSQEGYLLATSTNGPLLTNTSKGPKLMKAVDSEEWAIKAGAQWLEKTYGSNRPHVVHA
ENAKLGDQQYYIDSFYLNLKRLPIIGVVIIPRKFIMGKVDERAFKTLVILISASVCIFFIGCVCILILTNGVSKEMKLRA
ELIRQLDARRRAEASSNYKSQFLANMSHELRTPMAAVIGLLDILISDDCLSNEQYATVTQIRKCSTALLRLLNNILDLSK
VESGKLVLEEAEFDLGRELEGLVDMFSVQCINHNVETVLDLSDDMPALVRGDSARLVQIFANLISNSIKFTTTGHIILRG
WCENMNSLHDEMSLTVDRKKPWAPMKTKMMQHRNHLQKSCKNTNKMVLWFEVDDTGCGIDPSKWDSVFESFEQADPSTTR
THGGTGLGLCIVRNLVNKMGGEIKVVQKNGLGTLMRLYLILSTPDTADQNIQPDFSKYGLVVLLSMYGSTARMITSKWLR
KHGIATVEASDWNELTQIIRDLFETGSGDNSFDSQHNIADPLRAELSNIQEIENPVFVIVVDIGVLDLTTDIWKEQLNYL
DRFSSKAKFAWLLKHDTSNIVKTELRRKGHVMMVNKPLYKAKMIQILEAVIKNRKRSLCSGSRNRGNGSDESHDCLEIDP
TQFDTCSSDDSSETSGEKQVDKSVKPSILHPLLKNYLIDATNTNNDSTSASMTQKNPEEEDWKDRLYSGIALDGKNLKSL
EGIRILLAEDTPVLQRVATIMLEKMGATVTAVGDGQQAVESLNYRSINAEAPTHEEHKPSEEETAKSSLRSSSPYDLILM
DCQMPKMDGYEATKAIRRAEIGTELHIPIVALTAHAMSSDEAKCLEVGMDAYLTKPIDRKLMVSTILSLTKPSVFQTSLS
G*

DNA
ATGAGAGGAGATAGCTTCTCGATGAGTATTGAGAATCTTCCTGATTCTCCAATGGGTTCAAGAAGGAAGAAGATGAAGAT
CAGGAAAGTGTTTGATAAAATGACTGAGTTGGTTGCCCCTTGGAGAAGTAATTTAGAGAGTCCAAGAGAGAGGATGATTT
TGCGTGGTGATGTTGAGCAAGATGAGTTTCAGTACGCCAGTAGTCACTGTTTGTCTTCTTACTACAGCGTCTTTGTTGTT
CGCCTCGCTATAATGGTGATGCTAGCGATTCTGATAGGGCTTTTAACCGTTCTAACATGGCATTTCACGAGGATTTATAC
TAAGCAGTCGCTTCAAAACTTAGCATATGGCCTTCGGTATGAGCTTCTACAGCGTCCAGTCTTACGGATGTGGAGCGTTT
TAAACACCACATCCGAACTAACAACAGCTCAGGTCAAGCTATCTGAATATGTTATAAAGAAATATGACAAGCCAACTACT
CAAGAAGAACTCGTTGAGATGTATCAAGCAATGAAAGATGTGACTTGGGCTCTGTTTGCTAGTGCCAAAGCTCTAAATGC
CATCACCATAAATTACAGAAATGGGTTTGTCCAAGCTTTTCACAGAGATCCAGCAAGTAGCAGCACATTCTACATCTTCT
CCGATCTTAAGAATTATTCCATCAGTGGAACGGGGCCTGAAGATGTAAGCGGGTGGAACAACCAGTCAATACATGGGAAC
ATGTCTGCCATTTGGTACCAGCAACAGCTTGATCCAATAACAGGGGAAAAATTAGGAAAGCCTCTTAAAATTCCACCGGA
TGATCTGATCAACATTGCAGGAATCTCACAAGTGCCTGATGGTGAAGCTTCTTGGCATGTGACAGTGAGCAAATACATGG
ACTCTCCGCTTCTCTCAGCAGCTTTGCCGGTCTTTGATGCATCCAACAGGAGTATTGTGGCTGTTGTGGGGGTGACAACT
GCACTTTACAGTGTAGGGCAGTTGATGAGAGATCTTGTAGAGGTCCATGGTGGACATATTTATTTGACATCTCAAGAAGG
ATACTTGCTTGCTACTTCCACAAATGGTCCTCTTTTAACAAATACATCAAAAGGGCCTAAGCTAATGAAAGCCGTTGATT
CAGAGGAGTGGGCTATAAAGGCAGGAGCTCAGTGGTTGGAGAAAACTTATGGAAGTAACCGCCCTCACGTTGTTCATGCT
GAGAATGCAAAGCTTGGGGACCAACAATATTACATTGATTCATTCTATCTTAATCTAAAGAGACTTCCAATTATAGGTGT
TGTCATTATTCCCAGGAAGTTCATCATGGGAAAAGTGGATGAAAGGGCCTTCAAGACTTTGGTGATACTGATTTCTGCTT
CTGTCTGCATCTTCTTTATTGGATGTGTCTGCATCTTAATTCTCACAAATGGAGTTTCAAAGGAGATGAAACTAAGAGCA
GAACTGATAAGGCAGCTGGATGCAAGAAGACGAGCTGAAGCTTCAAGCAACTACAAAAGCCAGTTTTTAGCTAATATGAG
CCATGAGTTGAGGACACCTATGGCTGCTGTGATTGGATTACTAGATATTCTTATATCAGATGATTGTCTTTCAAATGAGC
AATATGCAACAGTGACTCAGATCAGAAAGTGCTCAACTGCTCTCCTTCGGCTTCTCAATAACATACTGGACTTGAGCAAG
GTTGAGTCAGGAAAGCTTGTTCTAGAAGAAGCTGAGTTTGATTTGGGACGAGAACTCGAAGGACTTGTTGACATGTTTTC
AGTGCAGTGTATTAACCACAATGTAGAGACAGTGTTAGACCTCTCTGATGATATGCCAGCATTAGTCCGAGGGGACTCGG
CTAGACTTGTTCAAATCTTTGCAAATCTTATAAGCAATTCTATTAAGTTTACAACAACGGGTCACATTATTCTTCGTGGA
TGGTGTGAGAACATGAATTCTCTACATGATGAGATGAGCTTAACTGTTGACAGAAAGAAACCATGGGCACCAATGAAGAC
AAAAATGATGCAACACAGAAATCATTTGCAGAAGTCTTGTAAGAACACAAACAAAATGGTTCTTTGGTTTGAGGTTGATG
ACACTGGATGTGGAATAGATCCAAGCAAATGGGACTCTGTGTTTGAGAGCTTTGAGCAAGCTGATCCTTCTACCACTCGG
ACGCACGGAGGAACTGGTCTTGGACTGTGTATCGTGCGGAACTTGGTAAACAAGATGGGTGGAGAAATCAAAGTAGTACA
GAAGAATGGCTTAGGGACTCTAATGAGACTATACTTGATTTTGAGTACTCCTGACACCGCAGATCAGAACATCCAGCCAG
ATTTCTCGAAATACGGCCTTGTGGTTTTGCTTTCCATGTATGGAAGTACAGCCAGAATGATCACATCGAAGTGGTTGCGT
AAACACGGGATTGCAACTGTTGAAGCATCAGACTGGAACGAGCTGACTCAAATCATTAGAGACCTGTTCGAGACGGGAAG
CGGTGACAACAGCTTTGATTCACAGCACAATATTGCTGATCCACTGAGAGCTGAGCTTTCAAATATACAAGAAATCGAGA
ACCCTGTGTTTGTCATAGTGGTGGATATTGGAGTACTTGATCTCACTACAGATATATGGAAGGAACAGCTTAACTACCTC
GACAGATTCTCCAGCAAAGCAAAGTTTGCTTGGCTGCTGAAGCATGACACCTCCAATATAGTTAAAACAGAACTTAGACG
AAAAGGCCATGTCATGATGGTTAACAAACCGTTGTACAAGGCCAAGATGATCCAGATTCTGGAGGCTGTAATAAAAAATC
GGAAGAGAAGCTTGTGTAGTGGCTCAAGAAACAGAGGAAACGGAAGTGATGAATCCCACGATTGCTTAGAAATCGATCCA
ACACAATTCGATACTTGCAGCTCCGATGATTCTTCTGAGACATCTGGCGAGAAACAAGTAGATAAATCTGTGAAACCAAG
CATCTTGCACCCACTTCTTAAGAACTATCTCATTGACGCTACTAACACCAATAATGATTCAACATCTGCAAGTATGACTC
AAAAGAACCCAGAAGAAGAAGACTGGAAAGATAGGCTGTATTCAGGGATTGCATTGGATGGAAAGAATCTGAAATCTCTT
GAAGGTATAAGGATCTTGCTAGCAGAAGATACACCGGTTCTTCAACGAGTAGCCACCATAATGCTTGAGAAAATGGGAGC
TACTGTAACTGCAGTAGGGGATGGACAACAAGCAGTTGAATCCCTCAACTACAGGTCTATCAATGCTGAAGCTCCAACTC
ATGAAGAACACAAACCGTCAGAAGAAGAAACTGCGAAGAGTAGTTTACGAAGTTCCTCACCTTATGACTTGATCCTCATG
GATTGCCAGATGCCAAAAATGGATGGATATGAGGCAACAAAGGCGATAAGGAGAGCAGAGATTGGCACTGAGCTGCACAT
TCCAATAGTGGCATTGACAGCGCATGCAATGTCTTCTGACGAAGCGAAATGCTTGGAGGTTGGAATGGATGCTTATCTCA
CAAAGCCTATAGACAGAAAGCTTATGGTCTCAACCATTTTGTCACTCACTAAACCATCAGTATTCCAAACTTCATTGTCC
GGTTGA