Details for Capsella Locus Carubv10012828m

Position : scaf_3 ( 5`- 2205769 .. 2211749 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012828m

Protein [Map View]
MATLSSSQSSFISCNENYSLDSIAASINDYILSLISDSESWIMLKQKCITLLRIEEEDTLFEFSSEHSALSNLYWGIDSI
EASIQPECSEEKTSRLRNSERMLQMPALLDEQGTTTSGVPNTILVAFSYFYLSIVSYLQGDSLQTTLHFLQSVLVSPEIV
RTGIAPQVFESIFFTPGVYKSDEEIREIARKYKYRATYYQVMSYGETHQPQSECTEKPLRRQMKYGQEISAANAHSVAEK
LELSETCEKLLQYQSHLHSVDLQEDELNDIFNKIKASRKIEKSTNNFEDSPPYLDWNLEEDYNPELGKSTRARCLNEFLK
ESQPDTSNSVCNTREDISTDTSANIFCVSQQEAHNEAYNEETLANRSHSLIGKFNRSIIDIQVQQAKTSWNTHLEDVSSL
RQLELEEISVFGHKGSITFEGMRRNLHTRKRGYGPETHSRRAPTMDLWKNLQSLIKEVLGNADEKYVSEVTMIYQMLNRK
EGFKYSMLKDVILDQLFTAISSSEEKTVIKASMTALTKIISVNRTALEEVKRKGLNLSHLANALKQNVQEAAILIYLIKP
SPTEIKSLELLPALVDVVASTSSSSSCYTLRPSPPLLTPPAASLMIIEVLITAFDHATNTMHLAAISSPSVLCGLLDVAK
SGNSGEFISLASILVKCMQFDGLNRKYIYQHTRVAPFAHLLQSKDREEIFIALQFLHEVLKIPRSSAIKILQQIKREGSF
DIKDTLLQCIKQLQGDHKLFAVDILLQLNALDSQPENKKYRNEATRALLDAVTCSEVPNMQLLSTFILSNIGGTYSWTGE
PYTAAWLMKRGGLTSMSHMNMIRNINWSDECLQDPGIDGWCCKIARRVIDTGKATFCGLQEGLKSKNKSVSKACLTAITW
LSIEISKGPNSLKYSACEVLLDEVAQFLHPGLELEERLLACICIYNFSSGKGIHKLVNFSEGVRESLRRLSYVTWMADEL
HKATYYLFSKSDQRISCVHTQTIELHHSGSGAVTALIYHRGLLFSGYSDGSVRVWNVNKKVATLLWDIKEHKSAVTCFSL
SESGERVLSGSADKTIRIWQIVKGKLECAEVIKTKDSIRKLEACGNMIFVITKGHKMKLLDSSRISQSIFKGKGVKSMVA
AQGKIYIGCIDTSIQELIVTNKREKEIRAPTRSWRLQNKPINSVVVYKDMLYSSSTHVEMSNIKDLRRNYDPQMSIPAEK
GSNVVAMGVVEDFIYLNRSSSANTLQIWLRRTQQKVGRLSAGSKITSLLTANDSVFCGTEAGVIKGWIPL*

DNA
ATGGCTACCCTTTCATCTTCTCAATCGAGTTTTATCTCTTGTAATGAGAATTATTCTCTTGATTCGATTGCAGCTTCTAT
CAACGACTACATTCTCAGCCTCATATCAGACTCCGAATCATGGATTATGCTTAAGCAGAAATGTATCACATTGCTGAGAA
TTGAAGAAGAGGATACTCTGTTTGAATTCTCTTCCGAGCACTCTGCTCTCTCGAATCTCTACTGGGGAATCGATAGCATC
GAAGCTTCTATACAACCCGAATGCTCAGAAGAGAAGACGTCTCGTCTGAGAAACTCTGAGAGAATGCTTCAAATGCCTGC
GTTGCTTGACGAACAAGGGACCACCACTTCAGGTGTTCCAAACACAATCTTGGTTGCTTTCTCTTACTTCTACCTCTCCA
TTGTGAGCTATCTCCAAGGTGATTCCTTGCAGACCACATTGCATTTTCTCCAGTCAGTTTTGGTCTCGCCGGAGATTGTA
AGAACCGGCATTGCCCCTCAAGTCTTCGAGAGCATTTTCTTCACTCCTGGTGTTTACAAGTCAGATGAAGAGATCAGAGA
GATTGCGAGGAAGTATAAATACAGAGCAACTTATTACCAGGTTATGTCTTATGGAGAGACTCATCAGCCACAGAGTGAAT
GTACAGAGAAACCGCTTCGAAGGCAGATGAAATATGGGCAAGAAATATCTGCGGCTAATGCTCATTCAGTTGCAGAGAAG
CTAGAATTGTCAGAAACCTGTGAGAAGTTATTGCAGTACCAGAGTCACCTCCACAGTGTTGATTTGCAAGAAGATGAGCT
TAATGACATCTTCAACAAAATCAAAGCATCAAGGAAGATTGAAAAATCTACAAACAACTTTGAAGATTCTCCTCCATATT
TGGATTGGAACCTGGAGGAAGATTACAATCCAGAGCTTGGAAAAAGTACAAGAGCCAGATGCCTCAATGAATTCTTGAAA
GAGTCACAGCCAGATACGTCAAACTCAGTATGCAATACTAGAGAAGACATCAGCACGGACACATCCGCCAACATCTTTTG
TGTTTCCCAACAAGAAGCTCACAATGAAGCATATAATGAGGAAACATTAGCCAACAGATCCCACAGCTTGATCGGTAAGT
TTAACCGTTCCATCATTGATATTCAGGTTCAACAAGCAAAGACAAGTTGGAATACGCACTTAGAAGATGTCTCTTCTTTG
AGGCAACTAGAGTTGGAAGAAATTTCAGTCTTTGGACATAAAGGGTCCATAACTTTTGAAGGAATGAGGAGAAATTTGCA
TACCAGGAAACGAGGATATGGACCTGAGACGCATTCTAGAAGAGCTCCGACGATGGATTTATGGAAGAACCTTCAGAGCT
TGATAAAGGAAGTGTTAGGGAATGCGGATGAGAAATACGTCTCAGAGGTTACAATGATTTATCAAATGCTGAACAGGAAA
GAAGGATTCAAGTATAGCATGCTAAAAGATGTCATTCTGGATCAGCTGTTTACGGCTATTTCTAGTTCCGAGGAGAAAAC
TGTCATAAAGGCATCGATGACCGCACTTACCAAGATCATATCAGTTAACAGAACAGCTCTTGAGGAGGTCAAGAGGAAGG
GTTTAAATTTAAGTCACTTAGCAAATGCCCTGAAACAAAATGTGCAAGAAGCAGCTATTCTCATCTACCTGATAAAGCCA
TCTCCAACAGAAATAAAGAGTCTTGAGCTTTTACCAGCTCTTGTTGATGTTGTTGCATCCACTTCGTCGTCTTCTTCTTG
TTACACATTGAGACCTTCACCTCCTCTTTTGACGCCGCCTGCTGCATCATTGATGATAATTGAAGTTCTTATTACTGCTT
TTGATCATGCCACAAACACAATGCACTTGGCTGCAATCAGCTCTCCTTCTGTCCTTTGTGGACTTCTTGATGTTGCAAAA
AGTGGAAATTCAGGGGAATTCATATCCTTGGCAAGTATTTTAGTAAAATGCATGCAGTTTGATGGACTTAACAGGAAGTA
TATCTATCAGCATACTCGAGTGGCTCCTTTTGCTCATCTCCTGCAGAGCAAAGACAGAGAAGAAATTTTCATTGCTCTTC
AATTTCTTCATGAGGTCCTGAAGATACCAAGGTCGTCAGCAATTAAGATTCTACAACAAATAAAAAGAGAAGGAAGTTTT
GACATTAAGGATACATTATTGCAGTGTATAAAACAGTTGCAGGGTGATCACAAACTCTTTGCAGTAGATATATTGCTTCA
GTTGAATGCACTGGACTCTCAACCTGAGAACAAAAAGTACAGAAATGAAGCTACCAGAGCTCTGCTTGATGCAGTTACAT
GTAGTGAAGTACCAAATATGCAGCTGTTATCAACCTTCATTCTTTCGAATATCGGTGGAACTTATTCATGGACAGGAGAA
CCGTACACTGCTGCTTGGCTAATGAAAAGAGGAGGTCTAACTTCAATGTCACACATGAATATGATAAGAAATATCAACTG
GTCAGATGAATGCTTACAGGATCCAGGAATAGATGGATGGTGTTGTAAAATAGCAAGAAGAGTTATTGATACAGGGAAAG
CCACGTTTTGTGGTTTACAAGAAGGGTTGAAGAGTAAAAACAAGAGTGTTTCAAAAGCATGTCTTACAGCCATTACATGG
CTCAGTATAGAGATTTCAAAAGGTCCAAATAGTTTGAAGTACTCAGCATGTGAAGTACTACTTGATGAGGTTGCACAATT
CCTACACCCTGGTTTGGAGCTTGAAGAAAGACTTCTTGCATGTATCTGCATCTACAATTTTAGCTCTGGAAAAGGAATCC
ACAAACTAGTAAATTTCTCGGAAGGAGTTAGAGAGTCTTTGAGACGTCTTTCATATGTGACTTGGATGGCAGACGAATTG
CATAAAGCAACATATTATCTATTCAGCAAATCTGACCAGCGAATATCTTGTGTTCATACACAAACCATAGAGTTGCATCA
CTCTGGCAGCGGAGCTGTAACAGCCCTCATCTACCATAGAGGCTTGCTCTTTAGTGGATACTCAGACGGTTCTGTCAGGG
TGTGGAATGTGAATAAGAAAGTAGCTACGCTGTTATGGGACATCAAGGAGCACAAAAGCGCCGTAACATGCTTTTCACTC
TCTGAATCAGGAGAGCGTGTCTTGAGTGGATCTGCAGATAAAACTATCAGGATATGGCAGATTGTTAAAGGAAAACTGGA
ATGTGCTGAAGTCATAAAAACAAAAGATTCAATAAGGAAACTGGAAGCATGCGGAAATATGATCTTTGTCATAACCAAAG
GTCACAAGATGAAGCTGCTTGATTCATCAAGAATATCTCAAAGTATCTTCAAAGGTAAAGGTGTGAAGAGTATGGTAGCA
GCCCAAGGAAAGATTTATATAGGATGTATAGATACAAGCATACAGGAATTGATCGTCACAAATAAACGGGAGAAAGAGAT
CAGAGCACCAACGAGAAGCTGGAGACTTCAAAATAAGCCTATCAATTCAGTGGTTGTGTACAAAGATATGTTATATAGCT
CAAGCACACATGTTGAGATGTCTAATATAAAGGATTTGAGAAGGAATTATGATCCCCAAATGTCAATACCAGCAGAAAAG
GGGTCTAACGTAGTAGCAATGGGTGTTGTTGAAGACTTCATCTACCTGAATCGAAGTTCATCCGCAAACACTCTTCAGAT
TTGGTTGAGAAGAACACAACAGAAAGTGGGAAGACTATCAGCAGGAAGCAAGATAACAAGCCTCCTTACTGCAAATGATA
GTGTTTTCTGCGGTACAGAAGCTGGAGTCATCAAGGGATGGATTCCATTATAA