Details for Capsella Locus Carubv10012826m

Position : scaf_3 ( 5`- 8897349 .. 8902752 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012826m

Protein [Map View]
MATKLPLQTSNNANVPKPRAAAAGKTIEEMYQKKSQLEHILLRPDTYIGSIEKHTQTLWVYENEEMVSRPVTYVPGLYKI
FDEILVNAADNKQRDPSMDSLQVVIDVEQNLISVCNTGDGVPVEIHQEEGVYVPEMIFGHLLTSSNYDDNVKKTTGGRNG
YGAKLTNIFSTEFIIETADGKRLKKYKQVFENNMGKKSEPVITKCNKSENWTKVTFKPDLTKFSMTELESDVVALMSKRV
FDIAGCLGKSVKVELNGKRIPVKSFSDYVDLYLRAANKSRTEPLPRMTEKVNDRWEVCVSVSDGQFQQVSFVNSIATIKG
GTHVDYVTSQITNHIVGIVNKKSKTANVKAHNVKNHLWVFVNALIDNPAFDSQTKETLTLRQSSFGSKCELSKDLLKKVE
KSGVVENLLSWADFKQSKDLKKTDGAKTGRVFVEKLSDANEAGGKNSQKCTLILTEGDSAKSLAMAGVSVVGHDYYGVFP
LRGKLLNVREASTTQITNNKEIENLKKILGLKQHMKYENVNSLRYGHMMIMTDQDHDGSHIKGLLINFIHSFWPSLLKVP
SFLVEFITPIVKATNKKTKRVLSFYSMPEYEDWKESLRGNATGWEIKYYKGLGTSDAKEGKEYFSNLSLHKKDFVWEDEQ
DGEAIELAFSKKKIEARKNWLSNYVPGTHLDQKEPKITYSDFVNKELILFSMADLQRSIPSMVDGLKPGQRKILFSAFKK
NLVKEMKVAQFSGYVAEHSAYHHGEQSLGSTIIGMAQDYLGSNNINLLKPKGQFGTRASGGKDAASTRYIFTVLSPATRV
LYPKDDDVLLDYLNEDGQKIEPTWYMPIIPTVLVNGSEGIGTGWSTFIPNYNPREIVANIRRLINGESVVPMDPWYRGFK
GTIEKSASKEGGCTYTISGLYEEVDDTTIRITELPIRRWTDDYKQFLESMKADNGAPFIQDIRAYNDHASVDFDIKLSEE
NMLEARQEGFLKKFKLTTTISTSNMHLFDKKGVIKKYASPEQILEEFFDLRNEYYEKRKETMLKNMELELLKLENKVKFI
LGVLSGEIIVNNRKKADLVEELRQRGFTPFPKKIMPVEAAVAGAIDAAEESEESSVDPVDSADAYIPGSEYDYLLAMAIG
SLTIEKVQELCEDRDKMLEAVEDLRKTTPRALWLRDLDSLDKELDKLDQADAKAEIERKVAQEKIRAKSGAPLKGRKQAP
KKPVAKKTTKKVSESETTEASAMDTDYNVAEVVKPKGRQGAKKKAPAAKEVEEDDMLDLAQRLAQYNFGSTSSKLTITFL
IKKH*

DNA
ATGGCTACCAAACTCCCGCTTCAAACCAGCAACAACGCAAATGTCCCAAAACCTCGAGCCGCCGCCGCCGGGAAGACGAT
TGAGGAAATGTATCAGAAGAAATCGCAGCTGGAACACATCCTGCTCCGTCCTGATACGTACATCGGATCGATTGAGAAAC
ACACCCAAACGCTTTGGGTCTATGAGAATGAAGAGATGGTTTCTCGTCCTGTTACCTACGTTCCTGGATTGTATAAGATC
TTCGATGAGATTCTTGTGAACGCTGCTGATAACAAACAGAGAGATCCGTCGATGGACTCTCTGCAAGTTGTGATCGATGT
TGAGCAGAATCTGATTAGTGTTTGTAACACTGGAGATGGAGTCCCTGTGGAGATTCATCAGGAAGAAGGTGTTTATGTGC
CTGAGATGATTTTTGGTCATTTGTTGACGAGTAGTAACTACGATGATAATGTGAAGAAGACCACTGGTGGAAGAAACGGA
TATGGTGCTAAGCTTACTAATATCTTCTCTACTGAGTTCATCATAGAGACTGCTGACGGGAAGAGACTCAAGAAGTATAA
GCAGGTCTTTGAGAACAATATGGGGAAGAAGTCAGAACCAGTTATAACCAAATGCAATAAGAGTGAGAACTGGACGAAGG
TTACATTCAAACCAGATTTGACGAAGTTTAGCATGACTGAATTGGAGAGCGATGTGGTTGCTTTAATGAGTAAGCGAGTG
TTTGATATTGCTGGATGTTTGGGGAAGTCTGTCAAAGTTGAGCTGAATGGCAAACGAATACCAGTCAAGTCATTCAGTGA
TTATGTGGATTTATACCTACGTGCGGCTAACAAATCAAGGACTGAGCCTCTCCCAAGGATGACTGAGAAAGTTAATGACA
GATGGGAAGTTTGTGTGAGCGTAAGTGATGGACAGTTTCAGCAGGTCAGCTTTGTCAACTCCATAGCAACGATCAAGGGT
GGTACTCATGTTGATTATGTGACGAGTCAGATCACAAACCATATTGTGGGTATTGTGAACAAAAAGAGTAAAACCGCTAA
CGTTAAGGCCCATAACGTAAAGAACCATCTGTGGGTGTTTGTCAATGCACTGATTGACAATCCTGCTTTTGATTCCCAAA
CAAAAGAAACTCTGACTCTTCGACAGAGCAGTTTCGGATCAAAATGTGAGCTTTCAAAAGATCTTTTGAAGAAAGTGGAA
AAATCTGGCGTAGTGGAGAATCTGCTTTCATGGGCTGATTTCAAGCAGAGCAAAGACCTAAAGAAAACTGATGGAGCCAA
AACAGGGAGGGTTTTTGTTGAGAAGTTATCGGATGCAAACGAAGCTGGAGGGAAGAACTCTCAAAAGTGTACGTTGATTT
TGACTGAAGGTGATTCAGCCAAGTCACTAGCGATGGCGGGTGTGTCTGTTGTGGGTCATGACTATTACGGTGTGTTTCCG
CTTCGAGGAAAGCTACTGAATGTTAGGGAAGCCAGCACCACTCAGATTACAAACAATAAGGAAATTGAGAACTTAAAAAA
AATTCTTGGGCTCAAGCAACATATGAAGTACGAGAATGTTAACTCATTAAGATATGGCCACATGATGATCATGACTGATC
AAGATCATGATGGTTCCCATATAAAGGGGCTCCTAATCAACTTTATCCACTCTTTCTGGCCGTCGTTACTCAAAGTTCCA
TCATTCCTGGTTGAGTTTATAACACCCATTGTGAAGGCTACGAACAAGAAAACTAAAAGAGTTTTGTCATTTTACTCAAT
GCCTGAGTATGAAGACTGGAAAGAAAGTCTGAGGGGTAATGCAACCGGATGGGAAATCAAATACTACAAGGGGCTGGGTA
CAAGTGATGCTAAGGAGGGGAAAGAGTACTTTAGTAATCTTAGTCTTCACAAAAAGGATTTTGTTTGGGAGGATGAACAA
GATGGAGAAGCCATTGAACTTGCTTTCAGTAAAAAGAAGATTGAAGCCCGAAAAAATTGGCTTTCAAACTATGTGCCTGG
CACTCATCTTGATCAGAAAGAACCAAAAATTACATACAGTGACTTCGTGAACAAAGAACTGATCTTGTTCTCCATGGCGG
ATCTTCAACGGTCAATTCCCTCAATGGTTGATGGGCTCAAACCCGGTCAGAGAAAGATACTTTTCTCTGCATTCAAGAAA
AACTTAGTTAAAGAAATGAAGGTTGCCCAATTCTCTGGATATGTAGCAGAGCACTCAGCTTATCATCATGGTGAGCAGAG
TCTTGGCAGCACTATCATAGGCATGGCACAGGATTACTTGGGGAGCAACAATATCAACTTGCTTAAACCAAAAGGTCAAT
TTGGTACACGAGCTTCGGGTGGAAAAGATGCAGCTAGTACAAGATACATTTTCACTGTACTCTCTCCAGCAACAAGGGTT
TTGTATCCCAAGGATGATGATGTCCTACTTGATTACTTGAATGAAGATGGGCAAAAGATAGAGCCAACTTGGTACATGCC
CATAATTCCAACTGTTCTTGTCAATGGCTCTGAAGGCATTGGAACTGGGTGGAGCACTTTCATACCGAACTATAACCCTA
GAGAGATTGTTGCTAACATAAGGCGTCTAATCAATGGTGAAAGTGTGGTTCCTATGGATCCTTGGTATAGAGGTTTTAAA
GGAACTATTGAGAAAAGTGCCTCTAAGGAAGGTGGTTGTACCTACACAATCTCTGGTCTATATGAGGAAGTTGATGACAC
AACTATCAGAATTACGGAGCTGCCCATCAGAAGGTGGACTGATGATTATAAACAATTCTTGGAGTCAATGAAGGCAGATA
ATGGTGCCCCCTTTATCCAGGACATCAGGGCATACAATGACCATGCATCTGTGGATTTCGACATTAAATTGAGTGAAGAG
AACATGCTGGAGGCTCGGCAAGAGGGCTTTCTGAAGAAATTCAAACTCACCACGACAATCTCTACAAGTAATATGCATCT
CTTTGATAAAAAAGGTGTTATAAAGAAATATGCGTCTCCAGAACAAATCCTTGAAGAGTTCTTTGACCTCAGGAATGAAT
ACTATGAGAAGAGAAAGGAAACTATGCTGAAGAATATGGAACTTGAGCTGTTGAAACTAGAAAACAAAGTGAAGTTCATT
CTTGGAGTTCTCAGTGGAGAAATCATAGTGAATAATAGAAAGAAAGCTGATCTTGTTGAGGAATTGAGACAGAGAGGGTT
CACACCATTTCCGAAGAAGATCATGCCTGTAGAGGCTGCAGTTGCTGGAGCAATTGATGCAGCTGAAGAATCTGAAGAAA
GCTCAGTGGATCCTGTAGATTCCGCAGATGCTTATATACCCGGCTCAGAGTATGACTACCTATTGGCAATGGCTATAGGA
TCGTTGACTATAGAGAAAGTTCAGGAGTTATGCGAAGACAGAGATAAAATGCTTGAAGCAGTTGAGGACTTGAGAAAAAC
CACACCGAGAGCCCTCTGGCTCAGAGACCTGGACTCTCTTGACAAGGAACTAGATAAACTTGATCAGGCCGATGCTAAGG
CCGAAATAGAAAGAAAGGTAGCACAAGAAAAAATCAGGGCCAAATCTGGAGCACCATTAAAGGGTAGAAAACAGGCGCCA
AAGAAACCGGTAGCAAAGAAGACAACAAAGAAAGTCAGTGAATCCGAAACAACAGAGGCTTCAGCGATGGACACTGATTA
CAACGTAGCAGAAGTGGTGAAGCCAAAAGGTAGACAAGGAGCCAAAAAGAAGGCTCCAGCTGCAAAGGAGGTTGAGGAGG
ATGACATGTTGGATCTAGCACAACGGCTTGCCCAATACAATTTTGGCTCAACAAGCAGTAAGCTAACAATCACATTCTTG
ATAAAGAAACATTGA