Details for Capsella Locus Carubv10012825m

Position : scaf_3 ( 5`- 3117791 .. 3124561 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012825m

Protein [Map View]
MEGEVRKYRERQARVQRGLVIQEQPIFQNMQHNQVPESDRRRLSLENLPGLYNLSCSQLLALANNTLGTSSSVGASPSSQ
YLMDFWIDSSSMESNPLISNPGSSLGINTGIPGERTMQTPQHDVPTPQKFLCDLNLTPEEMVSTSFQPTEPEIPPVTLDT
PGTRLSETDQKPHDPIKKSILETGSPSGVKRRKRPRIDENAQLKTPASKRKKIRPKVVREAKTNEASSKSGIKKPSVSAA
TATKPSEESSYIRPKRSRKRSVRLDFDLQDEDQEYCGLDFPSEYRTGGEGPTLGLFGSIPKGRRKKRIHANKRQQKINPS
SERGNDCLSSTLSLVNTGPAAFSESEEDIASNSHIYQSLGRKRSRLVTIPRNFGSLAKLLESIVPSKCSLPLLNVSEIQP
KVPRKKRRQRDPLASQLNARILHREWQSPKPKVTSFAEMWIRSMELDSVTKKLQELDINKKFQESALVLYQTLYEEQRVL
IKYSKKQLPKVDIDPETNRVFKLLMSSINNDGVDGLDEDKRKWWKDERNVFHERANSFIARMSIVQGDRTFSRWKGSVVD
SVVGVFLTQNVADHSSSSAYMDLAAEFPVNWNFNKRSSLEEWGSSATSNPRIRKSTCVIIEEIDDDDDEDGTDAVCAHES
SKTSDSSMSSTNQSTMTLLDPSAGTSTSSHCELNLNEVPHEVENCDVDALTNKFYEEIQVQHMSSHQQELDSTLQAQDQE
KNTRKEVVKNKEKKKPTTSRPVGRPPKNKVKESKKKSKKPAKSKLEDSFDWDSLRKQVESGGKKRERTERTLDTVDWDAL
RGSSVNKIAAIIIKRGMNNMLAKRIKDFLNRLVEEHGSIDLEWLRDVPPDKAKEYLLSINGLGLKSVECVRLLSLHQIAF
PVDTNVGRIAVRLGWVPLQPLPDQLQMHLLELYPVLNSVQKYLWPRLCKLDQKTLYELHYHMITFGKVFCTKLKPNCKAC
PMKAECRHYASAQRARLALPEPEVSDRTTVMLYERRYKRNPFVVNFRPSLLFSQENEQEAQRCEPIIEEPASPEPEYTMP
DIEDYPWDNNNVAMSTILENDPWEDKDIIPTIMLNKEAVTSTDLVVLSTQAAAIPTRKLKIMEKLRTEHLVYELPDYHSI
LQGFERREDEDIVPYLLAIWTPGETENSIQLPKQRCEFQGDNSTLCHEKKCFECNKIREEQSQIVRGTILIPCRTAMRGG
FPLNGTYFQTNEVFADHGSSINPIHVPRELIWKLPQRIAYFGSSVSSICKGLTVENIRENFKSGYVCVRGFDRVNRKSKT
LAKRLHCTKSKHN*

DNA
ATGGAAGGAGAAGTGAGAAAATATAGAGAGAGACAAGCTAGGGTTCAAAGGGGACTAGTCATACAAGAACAACCCATATT
TCAAAACATGCAGCACAATCAAGTGCCTGAATCAGACAGGAGGAGACTTAGTCTTGAGAACTTACCTGGCCTGTACAACT
TGTCTTGTTCACAACTACTGGCTCTGGCTAATAACACACTCGGCACAAGTTCATCAGTTGGTGCATCACCAAGTTCTCAA
TATTTGATGGATTTTTGGATTGATAGCTCGAGTATGGAGTCTAATCCGTTGATTTCCAACCCTGGATCCTCCCTTGGGAT
AAATACAGGCATTCCTGGAGAAAGGACAATGCAAACACCACAACATGATGTGCCAACTCCACAGAAGTTTCTTTGTGACC
TTAATCTTACACCTGAAGAGATGGTGAGCACCAGTTTCCAACCAACAGAACCTGAGATTCCTCCTGTGACATTAGATACG
CCAGGAACAAGATTGTCTGAAACTGATCAGAAGCCTCATGACCCTATCAAGAAGTCTATTCTTGAAACTGGATCTCCTTC
AGGAGTAAAGAGAAGAAAGAGACCACGAATTGATGAGAATGCGCAGCTGAAAACACCAGCATCAAAGAGAAAAAAGATCA
GGCCGAAGGTCGTTCGTGAAGCCAAAACAAACGAAGCCTCATCTAAATCAGGGATTAAAAAACCCTCTGTTTCTGCTGCG
ACTGCTACTAAACCTTCTGAAGAGAGCAGTTACATTCGGCCTAAAAGGTCGAGAAAAAGGTCTGTGCGACTTGACTTTGA
CCTTCAAGACGAAGACCAGGAGTATTGTGGTCTCGACTTCCCTTCAGAATATCGCACAGGTGGGGAAGGACCAACACTTG
GGCTATTTGGTAGCATCCCAAAAGGAAGACGGAAAAAAAGAATCCATGCCAATAAGAGACAACAAAAAATCAATCCGTCT
TCAGAACGAGGCAATGATTGCCTCAGTTCTACGCTGTCTCTTGTCAACACAGGACCAGCAGCTTTCTCTGAGTCAGAAGA
AGACATTGCAAGTAATTCACACATTTATCAAAGCTTGGGAAGAAAAAGATCAAGATTAGTGACCATACCGAGGAACTTTG
GGTCACTGGCGAAACTTTTAGAAAGTATTGTACCAAGCAAGTGCAGTCTTCCGCTGCTTAATGTCTCGGAGATACAACCA
AAAGTGCCTAGGAAGAAGCGGAGACAAAGAGATCCTTTAGCAAGCCAACTCAATGCAAGGATACTACACAGAGAGTGGCA
AAGTCCAAAACCAAAAGTTACATCATTTGCTGAGATGTGGATTAGAAGTATGGAACTCGATTCCGTCACTAAGAAGCTTC
AAGAGCTGGATATCAACAAGAAGTTTCAAGAAAGTGCACTTGTTCTATACCAAACCTTATATGAAGAGCAACGCGTACTG
ATAAAATATAGCAAGAAGCAGCTACCAAAAGTAGATATAGATCCCGAGACAAATCGAGTATTTAAACTCTTGATGTCGAG
TATCAACAACGACGGTGTTGACGGATTGGATGAGGACAAACGCAAATGGTGGAAAGATGAGAGAAACGTGTTCCATGAGA
GAGCAAACTCGTTCATTGCTAGAATGAGTATAGTGCAAGGGGATAGGACTTTCTCACGTTGGAAAGGATCTGTTGTGGAT
TCAGTAGTGGGAGTTTTCCTCACCCAGAATGTTGCAGATCATTCATCAAGTTCTGCATATATGGATCTTGCCGCTGAGTT
TCCTGTCAACTGGAACTTCAACAAGAGATCATCTCTTGAAGAGTGGGGAAGTTCAGCAACTTCAAATCCAAGAATTCGCA
AGTCAACTTGTGTCATCATAGAGGAGATTGATGATGATGATGATGAGGACGGCACTGATGCTGTTTGTGCTCATGAATCC
TCTAAAACCAGTGACAGTTCCATGAGCTCTACAAATCAGTCAACAATGACGCTGCTGGATCCATCTGCGGGCACGTCTAC
TTCTTCTCACTGTGAACTGAACCTAAATGAAGTACCACATGAAGTAGAGAACTGTGATGTTGATGCACTCACAAACAAAT
TCTATGAAGAAATTCAGGTTCAACATATGTCGAGCCATCAACAAGAACTGGACAGTACCCTTCAGGCACAAGACCAGGAA
AAGAACACAAGAAAGGAGGTTGTGAAGAACAAGGAGAAGAAGAAACCAACTACTTCCAGACCAGTAGGTCGACCACCCAA
AAACAAGGTGAAGGAATCAAAGAAAAAGTCAAAGAAACCAGCAAAGAGCAAGCTGGAAGACAGCTTTGACTGGGATAGTT
TGAGAAAGCAAGTAGAAAGTGGTGGCAAAAAGAGAGAGAGAACAGAAAGAACGCTGGACACAGTTGATTGGGATGCACTT
CGGGGTTCTAGCGTCAACAAGATCGCTGCTATAATCATAAAAAGAGGAATGAACAACATGCTTGCTAAGAGAATCAAGGA
CTTCCTAAATAGACTGGTTGAAGAACATGGAAGCATTGACTTGGAGTGGCTAAGAGATGTTCCCCCTGACAAAGCCAAGG
AGTATCTACTAAGCATAAACGGATTAGGATTGAAAAGTGTGGAGTGTGTTAGACTTTTGTCACTACACCAGATTGCATTC
CCTGTTGACACCAACGTTGGACGCATAGCTGTGAGACTAGGATGGGTTCCTTTACAGCCACTACCTGACCAGCTGCAAAT
GCACCTTTTAGAGCTGTACCCTGTATTGAATTCAGTTCAAAAGTATCTCTGGCCACGCCTCTGCAAGCTTGACCAAAAAA
CCTTGTACGAGCTGCATTACCACATGATCACATTCGGAAAGGTATTTTGCACCAAATTAAAACCCAATTGCAAAGCATGT
CCAATGAAAGCGGAGTGCCGACACTACGCTAGTGCACAAAGGGCACGTCTTGCTCTACCAGAACCGGAAGTGAGCGATAG
AACAACTGTAATGCTCTATGAGAGAAGGTATAAAAGAAATCCCTTTGTAGTTAATTTTCGGCCATCCTTATTGTTTTCTC
AAGAAAACGAGCAAGAAGCGCAAAGATGCGAACCGATCATCGAAGAACCGGCATCACCAGAACCAGAATATACAATGCCA
GACATTGAGGATTATCCTTGGGACAATAACAACGTTGCAATGTCTACGATCTTGGAAAATGATCCTTGGGAAGATAAGGA
TATAATTCCTACAATCATGCTCAACAAGGAAGCAGTTACATCAACGGATTTGGTGGTACTAAGCACACAAGCAGCAGCAA
TACCTACACGTAAACTCAAGATCATGGAAAAGCTACGTACAGAGCACCTTGTTTACGAGCTCCCTGACTACCATTCCATT
CTACAAGGGTTTGAGAGGCGAGAAGATGAGGATATAGTTCCCTATCTGTTAGCCATTTGGACTCCAGGTGAAACTGAAAA
TTCCATTCAACTGCCTAAACAAAGATGTGAATTCCAAGGAGACAACAGTACATTGTGTCATGAAAAGAAATGTTTCGAAT
GCAACAAGATACGGGAAGAGCAATCACAAATAGTGCGAGGAACTATCTTGATACCTTGCAGGACAGCAATGAGAGGAGGC
TTCCCACTGAATGGCACCTACTTCCAGACCAATGAGGTTTTTGCGGACCATGGCTCTAGTATCAACCCAATTCACGTCCC
AAGAGAACTGATATGGAAACTACCCCAAAGAATCGCATACTTTGGATCTTCTGTAAGCTCGATTTGTAAAGGTTTAACAG
TGGAGAATATCCGAGAGAATTTCAAGAGTGGATATGTTTGCGTGAGGGGATTCGACAGGGTGAATCGTAAGTCAAAGACT
CTAGCGAAAAGACTGCACTGCACAAAGAGCAAACATAATTAG