Details for Capsella Locus Carubv10012820m

Position : scaf_3 ( 5`- 4495663 .. 4503744 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012820m

Protein [Map View]
MARQMTSSQFHKSKTLDNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIVQEDLNTIMQEIDLLKNLNHKNIV
KYLGSSKTKTHLHIILEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKL
ADFGVATKLNEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDDNPPIP
DSLSPDITDFLRQCFKKDSRQRPDAKTLLSHPWIRNSRRALQSSLRHSGTIKYMRDPAASSEKDDEGSQDVAESLPAEKV
GMSKTDSKSKLPLVGVASFRSEKDQSTHSDLGEDGTDNSDDDVMSDQVPALSVHEKSSLQSGTLSISSDAKGTSQDGHGK
SEHDETAGNLETEASESRKNSSAIKQVGKECTVQVDQISHSSGLKSEDRGIRKAVKTPSSVGGNELSRFSDPPGDASLHD
LFHPLDKVPEGKPNEASTSMPTSNINQGDSPVADGGKNDLATKLRATIAQKQMEGETGHSNDGGDLFRLMMGVLKDDVID
IDGLVFDEKVPAENLFPLQAVEFTRLVSSLRPDESEDAIVSSCQKLVTMFRQRPEQKAVIVTQHGFLPLMDLLDIPKSRV
ICAVLQLINEIIKDNTDFQENACLVGLIPVVMSFAGPERDRSREIRKEAAYFLQQLCQSSSLTLQMFIACRGIPVLVGFL
EADYAKYREMVHLAIDGMWQIFKLKRSTPRNDFCRIAAKNGILLRLINTLYSLNEATRLASISGGALIVDGQAPRVRSGQ
LDPNNPIFTQHETSISMIDQPDVLKIRHGGGEEPSHASTSNSQRSDVHQPDALHPDGDKPRLSSVAPDASTSGTEDVRQQ
HRLSLSANRTSTDKLQKLADGVSNGFPVTQTEQVRPLLSLLEKEPPSRHYSGQLDYVKHITGIERHESRLPLLHGSNEKK
TNGDLDFLMAEFAEVSGRGKENGNLDTTPRYPGKTMTKKVLAIDGVASTSGIASQTASGVLSDVAREYLEKVADLLLEFA
RADTTVKSYMCSQSLLSRLFQMFNRVEPPILLKILECTNHLSTDPNCLENLQRADAIKHLIPNLELKDGHLVYQIHHEVL
SALFNLCKINKRRQEQAAENGIIPHLMLFIMSDSPLKQYALPLLCDMAHASRNSREQLRAHGGLDVYLSLLDDEYWSVIA
LDSIAVCLAQDNDNRKVEQALLKKDAIEKLVNFFQSCPERHFVHILEPFLKIITKSYRINTTLAVNGLTPLLISRLDHQD
AIARLNLLKLIKAVYEHHPRPKQLIVENDLPQKLKNLIEERRDGQRSGGQVLVKQMATSLLKALHINTVL*

DNA
ATGGCGCGGCAAATGACGTCATCTCAGTTCCACAAATCTAAGACTCTCGACAACAAATACATGCTGGGAGATGAAATTGG
TAAAGGAGCTTATGGTCGGGTTTATAAAGGATTAGACTTGGAGAATGGAGACTTTGTGGCCATTAAACAAGTCTCTTTGG
AAAACATTGTTCAAGAGGATCTTAACACCATTATGCAAGAAATTGATCTGTTGAAGAACTTGAACCATAAAAACATTGTG
AAGTATCTTGGGTCTTCGAAGACAAAGACTCACCTTCACATTATTTTGGAGTACGTTGAGAATGGCTCACTTGCAAACAT
TATTAAACCAAATAAATTCGGACCTTTCCCGGAATCGTTGGTGGCTGTTTACATTGCTCAGGTCTTGGAAGGTTTGGTAT
ATCTACACGAGCAGGGTGTCATACACCGTGATATCAAAGGTGCAAATATTTTAACGACAAAGGAGGGTCTTGTTAAGCTT
GCTGACTTTGGAGTTGCCACTAAACTTAACGAGGCTGATGTCAACACTCACTCAGTGGTTGGAACTCCTTACTGGATGGC
TCCTGAGGTTATTGAAATGTCAGGAGTTTGTGCTGCTTCTGACATTTGGAGCGTTGGATGCACTGTTATCGAACTTCTGA
CATGTGTACCTCCTTACTATGATCTGCAACCCATGCCAGCCCTCTTTCGTATTGTTCAGGATGATAACCCTCCTATCCCC
GATAGTCTTTCTCCAGATATTACAGACTTTCTAAGACAGTGCTTCAAGAAGGATTCCAGGCAGAGGCCTGATGCAAAGAC
ACTGCTCTCTCACCCTTGGATACGAAACTCTAGACGCGCATTGCAGTCATCACTTCGGCATAGTGGCACCATCAAATATA
TGAGGGACCCCGCTGCAAGTTCGGAGAAGGATGATGAAGGTAGCCAAGATGTAGCTGAAAGCCTTCCAGCAGAAAAAGTG
GGGATGTCAAAAACGGACTCAAAAAGCAAATTACCTTTGGTAGGGGTTGCGAGTTTTAGGTCTGAGAAAGATCAGTCTAC
ACATAGTGATCTAGGTGAAGATGGAACAGATAATTCAGACGATGATGTTATGTCAGATCAAGTTCCTGCACTTTCAGTCC
ATGAAAAATCTTCTCTTCAGTCTGGTACGTTAAGTATTTCTTCGGATGCTAAGGGGACGTCTCAAGATGGACATGGGAAA
TCTGAACATGATGAAACAGCTGGAAATCTTGAAACAGAAGCTTCTGAATCCAGAAAAAACAGTTCAGCAATAAAGCAGGT
TGGAAAAGAATGTACCGTCCAAGTGGACCAGATATCGCATAGTTCTGGCTTAAAAAGTGAAGATCGTGGGATTCGAAAGG
CTGTGAAAACTCCATCTAGTGTTGGTGGGAACGAACTGTCTAGATTTAGTGATCCTCCGGGGGATGCTTCTTTGCATGAT
TTGTTTCATCCATTGGATAAAGTTCCTGAGGGAAAACCAAATGAAGCTTCAACATCGATGCCTACATCAAATATCAACCA
AGGTGATTCTCCTGTTGCAGATGGTGGAAAAAATGATCTGGCAACAAAATTAAGGGCTACAATTGCTCAGAAACAAATGG
AGGGGGAAACGGGGCATTCAAATGATGGTGGTGATCTTTTTCGCTTAATGATGGGTGTTTTGAAAGATGATGTTATTGAC
ATTGATGGCTTGGTATTTGATGAAAAAGTTCCTGCGGAGAACCTTTTTCCTCTGCAGGCAGTCGAGTTCACAAGATTGGT
TAGCTCCTTAAGGCCAGACGAGTCAGAAGATGCAATAGTATCTTCTTGTCAGAAACTTGTAACCATGTTTCGTCAGAGAC
CTGAGCAGAAAGCAGTAATAGTGACTCAGCATGGCTTCCTGCCTCTAATGGATCTACTCGATATTCCTAAATCTCGAGTA
ATATGTGCCGTGCTGCAGCTGATAAACGAAATTATTAAAGATAATACTGACTTCCAGGAAAATGCTTGTCTTGTTGGTCT
TATTCCTGTTGTAATGAGTTTTGCTGGTCCTGAGAGGGATCGTTCTCGAGAAATTCGTAAGGAAGCAGCTTACTTCTTGC
AGCAGCTTTGTCAGTCAAGCTCCTTAACGTTGCAAATGTTCATAGCTTGCCGTGGAATACCCGTTTTGGTGGGATTTCTT
GAAGCAGATTATGCCAAATACAGGGAGATGGTTCACTTGGCTATTGATGGGATGTGGCAAATATTCAAACTCAAAAGATC
CACCCCAAGAAATGATTTCTGCCGTATAGCTGCAAAGAATGGAATTCTTCTGAGGCTAATCAACACTCTTTATAGCTTGA
ATGAGGCAACCCGGCTGGCTTCTATTTCAGGGGGAGCACTTATTGTGGATGGTCAAGCTCCACGAGTGCGCTCTGGTCAA
CTTGACCCTAACAATCCTATTTTTACTCAGCATGAGACTTCAATCAGTATGATTGATCAACCTGATGTATTGAAAATTAG
GCATGGCGGTGGTGAAGAGCCTTCTCATGCTTCAACTTCAAATTCTCAAAGATCAGATGTCCATCAACCAGATGCCTTGC
ACCCAGATGGCGATAAGCCTAGACTAAGCAGCGTTGCACCAGATGCTTCAACGTCTGGCACAGAAGATGTTAGACAACAG
CACAGACTATCTCTCTCTGCCAATAGGACATCGACAGATAAGCTTCAGAAGCTGGCAGACGGGGTTTCTAATGGTTTTCC
TGTTACTCAGACAGAACAAGTTCGACCTTTGCTTAGCTTGTTGGAGAAAGAACCCCCTTCAAGACATTATTCTGGTCAAC
TGGACTATGTTAAGCACATCACTGGCATAGAGAGACATGAAAGTAGACTTCCTCTTCTGCATGGATCAAATGAAAAGAAA
ACCAACGGAGACCTAGATTTTCTGATGGCTGAATTTGCAGAGGTCTCTGGACGTGGAAAAGAAAATGGAAATCTTGATAC
TACGCCTAGATATCCTGGTAAAACAATGACAAAGAAGGTTCTGGCTATTGATGGAGTTGCTTCGACGTCTGGTATTGCAT
CTCAGACAGCATCTGGAGTATTGTCAGATGTCGCTAGGGAATACTTAGAGAAAGTGGCTGACCTGCTTCTTGAATTTGCT
CGGGCTGATACGACGGTAAAGTCATACATGTGCAGTCAAAGCTTACTCAGTCGTCTTTTCCAGATGTTCAACCGTGTCGA
ACCTCCTATTCTGTTAAAGATACTGGAGTGCACCAATCATTTATCCACTGATCCAAATTGCTTGGAGAATCTGCAGCGTG
CAGATGCAATTAAGCATTTAATCCCCAACCTTGAGCTTAAGGATGGGCATCTTGTTTATCAGATTCATCATGAGGTGCTT
AGTGCACTATTCAACCTGTGCAAGATAAACAAGAGGAGGCAGGAACAAGCGGCTGAAAACGGAATCATTCCACACCTGAT
GCTTTTCATCATGTCTGATTCTCCCCTGAAACAATATGCATTGCCCCTACTATGTGATATGGCACATGCATCTCGGAATT
CAAGAGAGCAGTTACGCGCCCATGGCGGTCTGGATGTTTACCTGAGTTTACTCGATGATGAATATTGGTCCGTAATAGCC
TTAGATTCAATTGCTGTTTGCTTGGCGCAAGACAATGACAACCGCAAGGTTGAGCAGGCGTTGCTCAAGAAAGATGCAAT
TGAGAAATTAGTAAACTTCTTCCAGAGCTGCCCAGAGAGACACTTTGTGCACATATTGGAGCCATTCTTGAAGATAATCA
CGAAATCATATCGGATCAATACGACATTGGCTGTAAATGGATTGACTCCGTTACTCATCTCAAGGCTAGACCACCAAGAT
GCAATTGCTCGACTTAACCTACTAAAACTCATCAAGGCTGTTTACGAGCATCATCCACGGCCAAAACAGCTGATCGTAGA
GAATGACCTCCCGCAAAAACTGAAGAATCTGATAGAAGAACGACGTGATGGACAACGTTCAGGAGGCCAAGTTCTAGTAA
AGCAAATGGCAACATCTCTGCTCAAAGCACTTCACATTAACACCGTACTGTGA