Details for Capsella Locus Carubv10012818m

Position : scaf_3 ( 5`- 3881743 .. 3889102 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012818m

Protein [Map View]
MMAAPEDESSAQSQSSSATAAPPSASPSSAGDHYLAKCILRPSVVLQVAHGYFRSRSSRDIVFGKETCIELVIIGEDGVV
ESVCEQNVFGTIKDLCVIPQNNKLYSNRLQMGKDLLAVLSDSGKLSFLSFSNEMHRFSPIQHVQLSSLGNSRVQLGRMLT
VDSSGLFLAVTAYHDHFALFSLSTSSMGDIIHERISYPSEDGGNGSSVQAISGTIWSMCFISKDFNESKEYGPVLAIVIN
RKGSLINELVLFRWNVKEESMCLISEYVEAGALAHSIVEVPHSSGFAFLFRIGDALLMDLRDPQNPCCLFRTSLDLVPAS
LVEEHFVEDSCRVQDGDDEGLFNVAACALLELRDYDPMFIDTESDIGKLSSKHVSSWTWEPEINHNPRMIICLDDGEFFM
FELIYEDDGVKVNLSECLYKGLPCNKILWVDGGFLATFAEMADGTVFRLGTEKLHWMSSIQNIAPILDFSVMDDQNEKRD
QIFACCGVTPEGSLRIIRSGINVEKLLKTAPVYQGITGTWTVKMKLTDVYHSFLVLSFVEETRILSVGLSFKDVTDSVGF
QSDVCTLACGIVADGLLVQIHQDAIRLCMPTTDAHSDGIPVSSPFFSSWFPENVSISLGAVGQNLIVVSTSNPCFLSILG
IKSLSSQSCEIYEIQRVTLQYEVSCISVPQKNIGKKRSRASSLDNSCKAAIPSGMEQGYTFLIGTHKPSVEVLSFSEDGV
GVRVLASGLVSLTNTMGTVISGCIPQDVRLVLVDQLYVLSGLRNGMLLRFEWPPFSHTSGLNCPDYFSYCKEEMDIVVGK
RDDLPINLLLIATRRIGITPVFLVPFSDSLDSDIIALSDRPWLLQTARQSLSYTSISFQPSTHATPVCSSECPQGVLFVS
ENCLHLVEMVHSKRLNAQKFHLGGTPRKVIYHSESKLLIVMRTDLYDTCTSDICCVDPLSGSVLSSYKLKPGETGKSMEL
VRVGNEHVLVVGTSLSSGPAILPSGEAESTKGRLIILSLEHTHNSDSGSMTICSKAGSSSQRTSPFRDVVGYASEQLSSS
SLCSSPDDNSYDGIKLDEAETWQLRLASSTTWPGMVLAICPYLDHYFLASAGNAFYVCGFPNDNPERMKRFAVGRTRFMI
TSLRTYFTRIVVGDCRDGVLFYSYHEDSKKLLQIYCDPAQRLVADCFLMDGNSVAVSDRKGSIAILSCKDHSDFEYSSPE
SNLNLNCAYFMGEIAMAIKKGCNIYKLPADDGLQSNGLSKSINTADDTIIAGTLLGSIFVFAPISSEEYELLKAVQAKLG
IHPLTAPVLGNDHKEFRGRENQSQATKILDGDMLAQFLELTNRQQESVLSTPQPSQSTSKASSKQLSFPPLMLHQVVQLL
ERVHYALH*

DNA
ATGATGGCCGCTCCGGAGGATGAATCTTCCGCTCAGTCTCAATCATCCTCTGCCACGGCGGCTCCTCCATCCGCTTCTCC
TTCCTCCGCCGGGGATCATTACCTTGCTAAGTGCATCCTTCGCCCCAGCGTCGTTCTCCAGGTTGCTCATGGCTACTTCC
GCTCCCGTTCCTCCCGCGACATAGTTTTCGGCAAGGAGACATGCATAGAATTGGTGATTATTGGTGAAGATGGGGTTGTT
GAATCGGTCTGTGAACAGAATGTCTTTGGAACAATTAAGGATTTATGTGTCATACCTCAGAATAATAAACTATATTCAAA
TCGTTTGCAGATGGGGAAAGACCTTCTGGCTGTTCTTTCTGATTCTGGAAAGCTCTCTTTTCTCTCATTTAGCAATGAAA
TGCACAGGTTCTCGCCCATTCAACATGTTCAACTTTCTAGCCTAGGTAACTCAAGAGTTCAACTTGGAAGAATGCTCACA
GTAGATTCCAGTGGTCTCTTTCTTGCTGTCACTGCGTATCATGATCATTTTGCTCTGTTTTCCCTCTCAACATCGTCTAT
GGGTGATATTATTCACGAGAGGATTTCTTATCCTTCTGAAGATGGAGGGAATGGTAGCTCTGTACAAGCAATATCTGGTA
CTATTTGGAGCATGTGTTTCATTTCCAAAGATTTTAATGAATCCAAGGAGTATGGTCCTGTTCTTGCCATTGTTATAAAT
AGGAAAGGGTCTCTCATAAATGAGCTGGTTCTATTTAGATGGAATGTCAAAGAGGAATCCATGTGTTTAATATCAGAGTA
TGTTGAAGCTGGGGCTCTAGCACATAGTATTGTCGAAGTTCCTCACTCCTCTGGATTTGCCTTTCTGTTTAGGATTGGTG
ATGCGCTCTTAATGGATCTTAGAGATCCCCAAAACCCTTGCTGTCTGTTTAGGACATCCTTAGATCTTGTTCCTGCTTCA
TTAGTGGAAGAGCATTTTGTTGAAGACTCATGTAGAGTACAAGATGGAGACGATGAGGGCCTTTTTAATGTTGCTGCATG
TGCTTTGTTAGAGCTCAGGGATTATGATCCCATGTTCATAGATACTGAAAGCGACATTGGAAAGCTGAGTTCTAAGCATG
TCTCTTCATGGACTTGGGAGCCAGAAATTAATCATAATCCGCGGATGATTATTTGCTTGGATGATGGTGAATTTTTCATG
TTTGAACTCATATATGAAGATGATGGGGTTAAAGTAAATCTATCAGAGTGTTTATACAAAGGTTTACCATGCAACAAAAT
TTTATGGGTCGACGGTGGATTCTTGGCTACGTTTGCAGAAATGGCAGATGGAACGGTTTTCAGATTGGGAACTGAAAAGC
TACATTGGATGAGTTCCATACAAAATATTGCTCCGATCTTGGATTTTTCAGTTATGGATGACCAAAATGAGAAACGAGAC
CAAATATTTGCTTGCTGTGGTGTAACCCCTGAAGGCTCCTTGAGAATTATTCGTAGTGGCATTAATGTAGAAAAACTTCT
GAAAACCGCGCCTGTTTATCAAGGAATAACTGGTACTTGGACTGTTAAAATGAAGCTTACTGATGTATACCATTCATTTC
TTGTTTTGTCATTTGTTGAGGAGACCAGGATTTTATCAGTTGGTTTAAGCTTTAAAGATGTCACTGATTCAGTTGGTTTC
CAGTCTGATGTTTGCACCTTGGCATGTGGGATTGTTGCTGATGGGTTGTTGGTTCAGATTCACCAAGATGCAATAAGACT
GTGCATGCCCACAACGGATGCTCATTCTGATGGTATTCCCGTCTCTTCACCATTTTTCTCGTCGTGGTTTCCAGAAAATG
TCAGTATCAGCTTGGGTGCAGTTGGTCAAAATTTGATAGTTGTCTCTACGTCTAACCCTTGTTTCTTGTCCATTCTTGGG
ATCAAATCACTATCATCTCAATCCTGTGAAATCTATGAAATTCAACGAGTAACATTGCAGTATGAAGTTTCCTGCATCTC
AGTTCCTCAAAAAAATATTGGAAAAAAGAGATCCCGTGCTTCTTCCCTGGATAATAGTTGCAAAGCTGCAATTCCTTCTG
GTATGGAGCAAGGCTATACGTTTTTGATTGGCACACATAAGCCTTCTGTTGAGGTCCTCTCCTTCTCAGAAGATGGTGTC
GGTGTACGAGTCCTTGCTTCTGGATTGGTATCATTAACAAATACGATGGGAACTGTTATTAGTGGATGCATTCCTCAAGA
TGTAAGACTCGTGTTAGTTGATCAACTTTATGTCCTTTCTGGGTTGAGAAATGGGATGCTGCTTCGTTTTGAGTGGCCCC
CTTTTTCACATACATCCGGGTTGAATTGTCCAGATTATTTTAGTTATTGTAAAGAAGAGATGGACATTGTTGTGGGCAAA
AGAGACGATTTACCAATCAACCTTCTGTTAATTGCCACCCGACGCATTGGCATCACACCTGTTTTCTTGGTTCCGTTCAG
TGATTCACTTGATTCAGACATCATAGCTCTTAGTGACAGGCCATGGTTGTTACAAACAGCTCGACAAAGCCTTTCTTATA
CTTCCATCTCATTCCAACCTTCTACTCATGCAACTCCTGTATGTTCGTCTGAATGCCCTCAAGGAGTTCTTTTTGTTTCA
GAGAACTGTTTACATCTGGTTGAGATGGTGCACAGCAAACGGCTTAATGCACAAAAATTTCACCTTGGAGGCACCCCGCG
AAAGGTTATCTACCATAGTGAAAGCAAACTATTAATTGTCATGAGAACGGATCTGTATGATACGTGTACGTCTGATATAT
GCTGTGTGGACCCGCTCAGTGGGTCAGTCTTATCATCTTACAAGCTCAAACCTGGAGAAACTGGAAAGTCAATGGAGCTT
GTGCGTGTGGGTAATGAGCATGTCCTTGTGGTTGGGACGAGTTTGTCTTCTGGTCCTGCTATACTACCCAGTGGTGAAGC
TGAAAGTACAAAAGGACGATTAATCATTCTTTCCTTAGAACACACTCATAATTCGGATAGTGGCTCAATGACAATTTGTT
CAAAGGCTGGTTCTTCTTCTCAACGTACATCACCTTTTCGTGATGTTGTGGGATACGCATCAGAACAACTATCAAGCAGT
AGTCTCTGTAGCAGTCCAGATGATAACAGCTATGATGGAATCAAGCTTGATGAAGCTGAAACATGGCAGTTAAGATTGGC
CTCTTCAACCACTTGGCCGGGTATGGTACTTGCAATCTGTCCATACCTTGATCATTACTTCCTGGCGTCTGCCGGCAATG
CTTTCTATGTATGTGGTTTTCCGAACGATAATCCTGAGAGAATGAAGAGGTTTGCGGTGGGAAGGACTCGTTTTATGATA
ACATCTCTGCGAACATACTTTACTAGAATTGTCGTTGGTGATTGCCGTGACGGTGTTTTATTTTATTCTTATCACGAGGA
CTCGAAGAAACTTCTCCAAATATATTGTGATCCGGCGCAGAGGTTAGTTGCTGACTGCTTTCTAATGGATGGCAATTCTG
TTGCTGTATCTGATCGCAAAGGGAGTATAGCAATCCTGTCTTGCAAAGATCATTCAGACTTTGAATATTCAAGTCCGGAG
TCCAATCTGAATCTAAACTGTGCTTATTTCATGGGAGAGATTGCCATGGCTATCAAAAAGGGTTGCAACATTTATAAACT
TCCAGCTGATGATGGACTGCAAAGTAATGGTCTTAGTAAAAGTATTAACACAGCTGATGACACTATCATAGCAGGCACGC
TCTTGGGAAGTATATTTGTCTTTGCTCCTATTTCAAGTGAGGAATATGAGCTCTTAAAAGCTGTCCAAGCAAAGCTCGGG
ATCCATCCGCTGACTGCTCCTGTTCTCGGTAACGATCATAAGGAGTTCCGAGGTCGAGAGAATCAGTCCCAAGCAACAAA
GATATTGGATGGTGACATGCTAGCTCAGTTCTTGGAGCTTACAAATAGACAGCAGGAGTCAGTTTTATCGACACCTCAGC
CATCACAAAGCACATCAAAAGCAAGTTCAAAACAACTTTCTTTTCCGCCTCTCATGTTACACCAAGTTGTACAGTTGCTC
GAGCGTGTCCATTACGCTTTACACTAG