Details for Capsella Locus Carubv10012816m

Position : scaf_3 ( 5`- 4377271 .. 4383750 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012816m

Protein [Map View]
MASSPGNTNPHNPPPFDLGILFKPSSNPYPAPPASYPPPTGPFLHNQYDQQHYALPAISAQPSPVTQAQQDVSSSSLATN
LHPQRTLSYPTPPLNLQSPRSNHNPGTHILALLNNNNGGAVANQEPSHQPPLVNHNEIARSFPGGSGPIRVPSCKLPKGR
RLIGEHAVYDVDVRLQGEIQPQLEVTPITKYGSDPQLVVGRQIAVNKVYICYGLKGGNIRVLNINTALRSLFRGHSQRVT
DMAFFAEDVDMLASVSLDGKVFVWKISEGSEGDDQPQITGKIVCALQILGEQDTKHPRVCWHCHKQEILVVSIGRHVLRI
DTTKVGRGEVFSAEAPLQCPLDKLIDGVQIVGKHDGEVTDLSMCQWMTTRLVSSSVDGTIKIWQDRKAQPLVVLRPHDGH
PVSSATFVTSPERPDHIILITGGPLNREMKIWVSAGEEGWLLPADSESWRCTQTLALKSSTESRAEEAFFNQVIALSEAG
LLLLANAKRNALYAVHLDYGNSPVETRMDYLSEFTVTMPILSFIGTNDPPEEPIVKVYCVQTLAIQQYTLDLSLCLPPPV
ENMGLEKSDSNVSREANLVESTSEPSGLKPTDLPSVDSVPKPSIIVNRSESANKLSFTSAEATAQAIVPPNGEPKTSALP
SETSGAGSAYATSPKLPLSPRLSRKLSGYHSPVDAIEPVTPHHELGGRAPSADYSVDRQMDAVGVSSCDVSSIEENSRSK
DPNVTPDDDLSGMRSPAAFFKHPTHLVTPSEILMGVSSAEASTTNEDRRDRDANNFQDVNNDARGAEVEVKEVSDTRSTQ
NGETNDNDETANRTSENREKVFCSQVSNLSTQMARDCYPSTEGTFIPGESKAYGEPIQAGDESGLDTRGVSAKLPESGSS
SGLQQSSAANSKGKKQKAKNSQGPSLSSSSSNLAESFNEQRESLSHPMTDPLPQFLAMQEHESGDILILKPISTLFLTIS
VFILLHHSVIHYKICYYLDLAHKSSFILKQKSVFVPNWQLSMIGYRFILRRTLIMASQKEMQRQLSNAVTGPIVKESKRL
EVALGRMIEKSSKSNADALWARFQEETAKNEKALRDHSQQIVSATTNFMSKELNAMFEKTIKKELAAIGPALARSVTPVI
EKTVSSAITESFQRGIGDKAVNQLEKSVNLKLEATIARQIQAQFQTSGRQALQEALRSGLESSVIPSFERACKTMFDQMD
SAFQKGIAEHTNAAQQRLDSGHSQLAHTLRETITSASSVAQALSRELAENQRNFLALAAAGANSGGSNPLITQLSGGPLG
ALLEKAEAPKDPTTELSRLISERKYEESFTSALQRSDVSIVSWLCSQVDLRGLLAMNPLPLSQGVLLSLLQQLACDISKD
TSRKLGWMTDVVAAINPSDQMIAVHARPIFEQVYQILHHHRNAPGSDVSAIRLIMHVINSMLMGCK*

DNA
ATGGCGTCTTCTCCTGGTAATACCAATCCTCACAATCCTCCTCCGTTTGATCTCGGTATTCTCTTCAAACCTTCATCCAA
TCCTTACCCGGCGCCGCCCGCATCTTATCCTCCCCCCACAGGTCCATTTCTTCACAACCAGTACGATCAGCAGCACTACG
CTCTGCCTGCTATATCCGCTCAGCCATCGCCGGTCACTCAGGCGCAACAGGATGTCTCTTCCTCTTCCTTGGCGACTAAC
TTGCACCCACAGAGAACGCTCTCTTATCCCACGCCACCTCTCAATCTCCAATCTCCCCGTTCCAATCACAATCCTGGAAC
GCACATCCTCGCTCTCCTCAACAACAACAACGGAGGCGCCGTGGCTAACCAAGAGCCATCCCATCAACCCCCGTTAGTGA
ATCACAACGAGATCGCGCGTTCTTTCCCCGGTGGTTCGGGTCCTATTCGTGTCCCGAGCTGTAAGCTTCCCAAAGGAAGG
CGATTGATTGGTGAACACGCCGTGTACGATGTAGATGTGAGATTACAAGGGGAGATTCAGCCACAGCTGGAGGTGACTCC
GATTACCAAATACGGTTCGGATCCTCAGCTAGTTGTGGGTCGGCAAATCGCAGTGAATAAGGTCTATATATGCTATGGAT
TGAAAGGAGGAAACATTAGGGTTCTCAATATAAACACAGCATTAAGATCTCTGTTCCGGGGCCATTCTCAGAGAGTGACG
GATATGGCTTTCTTTGCCGAGGATGTTGATATGTTGGCCAGTGTTAGTCTAGATGGAAAAGTTTTCGTGTGGAAAATTTC
TGAAGGATCTGAGGGAGATGATCAACCCCAGATAACTGGAAAGATAGTTTGTGCTCTACAGATTCTAGGAGAGCAAGACA
CCAAACATCCACGTGTTTGTTGGCACTGCCACAAACAGGAAATTTTGGTAGTTTCTATTGGTAGACATGTGCTGCGAATT
GATACTACAAAAGTTGGCAGAGGTGAAGTATTCTCTGCTGAGGCACCTCTCCAGTGTCCCCTTGATAAGCTGATTGATGG
TGTCCAGATTGTGGGTAAACATGATGGAGAAGTTACAGATTTGTCAATGTGCCAATGGATGACCACGCGCCTGGTTTCTT
CTTCTGTTGATGGCACGATTAAGATATGGCAAGATCGTAAAGCACAACCACTTGTAGTTTTGAGGCCTCATGATGGACAT
CCAGTCAGTTCAGCCACGTTTGTGACATCTCCTGAGAGACCTGATCACATCATACTTATCACAGGGGGTCCTCTCAATCG
AGAAATGAAAATCTGGGTCTCTGCTGGAGAAGAAGGGTGGCTTCTACCAGCTGATTCTGAATCATGGAGGTGTACTCAGA
CACTTGCCTTGAAAAGTTCAACTGAGTCACGGGCTGAAGAGGCATTTTTTAATCAAGTCATAGCATTATCTGAAGCAGGC
TTGCTTTTACTTGCAAACGCAAAAAGGAACGCCTTATATGCTGTGCATTTGGACTATGGTAACTCCCCTGTTGAAACGCG
GATGGATTACCTGTCAGAGTTTACAGTCACTATGCCCATATTGAGTTTTATTGGGACAAATGATCCTCCAGAAGAGCCCA
TTGTTAAGGTTTATTGTGTTCAGACTCTAGCAATTCAGCAGTATACATTAGACTTGAGCTTGTGCTTGCCACCACCTGTA
GAGAATATGGGTTTGGAGAAGTCAGATTCTAATGTATCGCGAGAGGCAAACCTTGTTGAAAGCACGTCAGAACCATCTGG
ACTGAAACCTACAGACTTACCTTCAGTTGATTCAGTGCCAAAACCTTCTATTATAGTGAATAGATCGGAAAGTGCTAATA
AGTTGAGTTTTACATCCGCCGAAGCCACAGCACAAGCAATTGTTCCACCCAACGGTGAACCAAAAACTTCTGCCTTGCCA
TCTGAGACCAGTGGTGCAGGTTCTGCGTATGCTACGTCACCCAAACTTCCTCTAAGTCCCAGACTATCAAGAAAACTTTC
TGGCTATCACAGTCCTGTAGATGCTATTGAGCCAGTAACACCTCATCATGAGCTTGGTGGCAGAGCACCTTCGGCTGACT
ATTCTGTTGATAGGCAAATGGATGCTGTTGGAGTAAGTAGTTGTGATGTGTCATCCATAGAAGAAAATTCAAGAAGCAAG
GACCCAAATGTTACACCTGATGATGATTTGTCCGGGATGCGAAGCCCAGCAGCCTTTTTCAAACACCCCACTCATCTTGT
AACTCCTTCAGAGATATTGATGGGCGTTTCGTCTGCTGAAGCCTCCACCACCAATGAAGACAGGAGAGATAGAGATGCAA
ATAATTTTCAGGACGTGAATAATGATGCAAGAGGTGCAGAAGTTGAGGTGAAAGAAGTAAGTGACACAAGGTCAACACAG
AATGGTGAAACCAATGATAATGATGAAACTGCGAATCGCACTTCAGAAAATAGAGAAAAAGTCTTCTGCTCACAGGTTTC
AAATCTCAGCACCCAGATGGCAAGAGACTGTTATCCTAGTACAGAAGGAACTTTCATACCAGGGGAATCTAAGGCTTATG
GAGAACCTATACAGGCTGGAGATGAAAGTGGTCTTGACACGAGAGGTGTGTCTGCAAAGCTTCCTGAGTCGGGTTCATCT
AGTGGGCTTCAACAGTCGTCAGCTGCAAATAGCAAAGGGAAGAAGCAGAAGGCCAAAAATTCACAGGGTCCCAGTCTGTC
ATCTTCATCCTCAAATCTGGCTGAATCCTTCAATGAGCAACGTGAGAGCTTAAGTCATCCCATGACAGATCCACTTCCTC
AGTTCCTAGCTATGCAAGAACATGAATCAGGTGACATATTGATCTTGAAACCAATTAGTACTCTATTCTTAACAATATCT
GTATTTATACTCTTACATCATTCAGTGATTCACTATAAAATTTGTTATTACCTTGATTTGGCACACAAGAGTTCCTTCAT
TTTAAAACAAAAATCAGTTTTCGTACCTAACTGGCAGTTATCGATGATAGGTTATCGCTTCATCTTAAGACGCACCTTGA
TAATGGCTTCGCAGAAGGAGATGCAGAGACAACTATCAAATGCTGTCACTGGCCCTATCGTAAAGGAAAGTAAAAGACTA
GAAGTGGCGTTAGGGAGAATGATTGAGAAATCCAGCAAGTCAAATGCTGATGCTCTATGGGCTCGCTTCCAAGAGGAGAC
TGCTAAGAATGAAAAGGCATTGCGTGACCATTCACAGCAAATTGTGAGTGCAACAACAAACTTCATGAGCAAGGAGTTAA
ATGCCATGTTTGAGAAAACGATAAAGAAGGAACTTGCTGCAATTGGTCCAGCCCTTGCACGTTCAGTTACACCGGTTATT
GAAAAAACTGTATCTTCTGCAATCACAGAGTCCTTCCAGAGAGGAATTGGTGACAAAGCAGTTAATCAGCTTGAAAAATC
TGTTAATTTAAAGCTTGAAGCAACAATAGCTAGGCAAATTCAAGCCCAATTTCAGACCTCTGGCAGGCAAGCCCTCCAGG
AAGCGCTTAGGTCGGGTCTAGAGTCCTCAGTCATACCTTCTTTTGAGAGGGCATGCAAGACAATGTTTGATCAAATGGAC
TCAGCTTTCCAGAAAGGGATTGCTGAGCATACAAATGCAGCCCAGCAACGCCTTGACTCTGGACACTCCCAGCTTGCTCA
TACTTTAAGGGAAACAATTACTTCTGCATCATCAGTTGCTCAAGCCTTAAGTCGTGAATTAGCCGAGAACCAAAGGAATT
TCCTAGCTCTCGCAGCTGCTGGAGCAAATTCTGGCGGGTCAAATCCCTTGATTACTCAACTAAGTGGCGGACCTTTGGGT
GCTCTTCTTGAAAAGGCTGAAGCACCTAAGGACCCAACAACTGAACTTTCAAGGTTGATATCTGAACGCAAGTACGAAGA
ATCTTTCACTTCTGCTCTACAGAGAAGCGATGTCTCTATAGTATCATGGCTTTGTTCTCAGGTGGATCTTCGTGGACTAT
TGGCTATGAATCCACTTCCGCTGAGTCAAGGCGTGCTTCTTTCGCTGCTGCAGCAGCTAGCCTGCGACATAAGCAAGGAC
ACATCTCGTAAGCTTGGTTGGATGACTGATGTGGTGGCAGCCATAAACCCATCAGATCAGATGATTGCAGTTCACGCTCG
CCCAATCTTTGAACAGGTCTATCAGATTCTGCACCATCACCGAAACGCACCGGGGAGCGATGTCTCAGCCATCAGACTGA
TAATGCACGTCATAAACTCCATGCTGATGGGCTGCAAGTGA