Details for Capsella Locus Carubv10012815m

Position : scaf_3 ( 5`- 6325627 .. 6330623 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012815m

Protein [Map View]
MAVSAGALAFPPALSVRATLSPENKDEQQGNISSTSSTQKFTYSRASPAVRWPHLNLRETYDSRTSTPSQPVSSPLSSTD
VSDIPDSGEVVDSIGASAQQKTKGDEAAIVASRRRRVKKLNKVALIKAKDWRERVKFLTDKILSLKPNQFVADILDARPV
QMTPTDYCFVVKSVGQESWQRALEVFEWLNLRHWHSPNARMVAAILGVLGRWNQESLAVEIFTRAEPTVGDTVQVYNAMM
GVYSRSGKFSKAQELLDAMRHRGCVPDLISFNTLINARLKSGGLTPNLAVELLEMVRTSGLRPDAITYNTLLSACSRYSN
LEGAVKVFEDMEAHRCQPDLWTYNAMISVYGRCGLATEAERLFTELELKGYFPDAVTYNSLLYAFARERNTEKVKEVYQE
MQKMGFGKDEMTYNTIIHMYGKQGQLDLALQLYKDMKGLSGRNPDAITYTVLIDSLGKANRTVEAATLMSEMLDVGIKPT
LQTYSALICGYAKAGKREEAENTFSCMLRSGTKPDNLAYSVMLDILLRGNETIKAWVLYRDMISDCLTPSHGLYELMILG
LMKENRSDDIQKTIRDMEELCGMNPLEISSVLVKGECFDLAARQLKVAITNGYDLENDTLLSILGSYSSSGRHSEAFELL
EFLKDHASGSKRLINEALTVLHCKVNNISAALDEYFADPCVHGWCCGSSTMYETLLHCCVANEHYAEASQIFSDLRLSSC
EASESVYKSMVVVYCKLGFPETAHQVVNQAETKGFHFACSPMYTDMIEAYGKLKLWQKAESVVGNLRQSGRTPDLKTWNS
LMSAYAECGCYERARAIFNTMMRDGPPPTVESINILLHALCVDGRLEELYVVVEELQDMGFKISKSSILLMLDAFARAGN
IFEVKKIYSSMKAAGYLPTIRLYRMMIELLCKGKRVRDAEIMVSEMEEANFKVELAIWNSMLKMYTAIDDYKKTVQVYQR
IKETGLEPDETTYNTLIIMYCRDRRPEEGYLLMQKMRNIGLDPKLDTYKSLISAFGKQKCLEQAEQLFDELLSKGYKLDR
SFYHTMMKISRDSGSEFKAEKLLQMMKNAGIEPTLATMHLLMVSYSSSGKPQEAEKVLSNLKETDVELTTLPYSSVIDAY
LRSRDYNSGIERLLEMKKEGLEPDHRIWTCFVRAASFSKEKSEVILLLKALQDIGFDLPIRLLAGRAELLVPEVDGWFEK
LKPIEDNAALNFANALLNLLWAFELRATASWVFQLAIKRDIFSRDVFRVADKDWGADFRRLSGGAALVALTLWLDHMQDA
SLEGYPESPKSVVLITGTAEYNGISLDKTLKACLWEMGSPFLPCKTRTGLLVAKAHSLRMWLKDSPFCFDLELKDSVLLP
ESNSMDLIDGCFIRRGLVPAFNHIKERLGGFVSPKKFSRLALLPDEMRERVIKRDIEGHRQKLEKMKKKNKGNEVISVNT
RRKFVRSK*

DNA
ATGGCGGTTTCTGCAGGGGCTTTAGCTTTTCCTCCTGCTTTATCCGTTCGCGCCACCCTTAGTCCGGAGAATAAAGATGA
ACAACAAGGGAACATCAGCAGCACTAGCTCTACCCAGAAATTCACTTATAGTCGAGCTTCTCCCGCTGTCCGATGGCCAC
ATTTGAATCTCCGTGAGACTTACGATTCCAGAACTTCAACACCATCCCAACCCGTTTCTTCTCCTCTTTCTTCAACCGAT
GTCTCCGATATACCGGATTCCGGTGAAGTCGTCGACTCAATTGGCGCCAGCGCGCAGCAAAAGACGAAAGGTGATGAAGC
CGCCATCGTGGCGAGTCGGAGAAGGAGAGTGAAGAAATTGAACAAGGTGGCTCTGATAAAGGCCAAGGATTGGAGAGAGA
GGGTGAAGTTTCTGACTGATAAGATTCTGAGCCTGAAACCTAATCAGTTCGTTGCGGATATTCTCGATGCTCGCCCTGTT
CAGATGACTCCTACGGATTACTGTTTCGTCGTCAAATCGGTTGGTCAGGAGAGCTGGCAACGAGCTCTTGAGGTTTTTGA
GTGGCTCAATCTCCGTCATTGGCACTCACCTAATGCTCGTATGGTGGCAGCTATACTCGGTGTTTTGGGACGGTGGAATC
AGGAGTCGCTTGCGGTTGAGATTTTCACTAGGGCTGAGCCAACCGTCGGAGACACCGTTCAAGTGTACAACGCAATGATG
GGGGTGTATTCTCGTAGTGGCAAGTTTTCAAAGGCACAAGAGCTGCTCGATGCAATGCGTCACAGAGGGTGTGTTCCAGA
CCTTATTAGTTTCAATACTCTTATCAATGCCAGGCTTAAGTCGGGTGGGTTGACTCCAAATCTGGCTGTTGAGCTATTAG
AGATGGTGAGGACTTCGGGTCTTAGGCCAGATGCTATCACTTACAACACTCTTCTTAGTGCCTGTTCGCGGTATTCTAAT
TTGGAGGGTGCAGTTAAGGTTTTTGAGGACATGGAAGCTCATCGGTGTCAGCCTGACTTGTGGACTTATAATGCCATGAT
ATCTGTTTATGGAAGATGTGGGCTCGCTACTGAAGCCGAGAGGCTCTTCACGGAGCTGGAGCTTAAAGGTTATTTTCCTG
ATGCAGTGACATACAACTCTTTGCTCTATGCTTTTGCTAGGGAAAGAAATACAGAGAAGGTGAAAGAGGTGTACCAAGAA
ATGCAGAAAATGGGGTTTGGGAAAGACGAGATGACTTATAACACGATCATTCACATGTATGGCAAGCAGGGGCAACTTGA
TCTTGCGCTGCAGCTTTATAAGGACATGAAAGGTTTGTCAGGTAGAAATCCTGATGCTATTACTTACACTGTTTTGATTG
ATTCACTTGGAAAAGCAAACAGAACAGTGGAAGCCGCAACTTTAATGTCTGAGATGCTTGACGTTGGGATCAAACCAACT
CTGCAGACCTACAGTGCTCTTATCTGCGGTTATGCCAAGGCTGGGAAGCGAGAGGAGGCTGAGAATACTTTCAGTTGCAT
GTTGCGCTCAGGCACTAAACCTGATAATTTAGCGTATTCTGTGATGTTGGATATATTACTAAGAGGCAACGAGACAATAA
AGGCATGGGTTTTATATCGTGATATGATTTCTGACTGTCTTACACCGTCTCACGGTCTGTATGAGTTGATGATACTTGGA
CTTATGAAGGAAAACAGGTCAGACGACATTCAGAAAACCATCAGAGACATGGAAGAATTGTGTGGCATGAACCCACTAGA
AATTTCATCAGTTCTTGTTAAGGGTGAATGCTTTGACCTTGCTGCTAGACAGTTGAAAGTGGCTATCACCAATGGGTATG
ACTTGGAAAACGACACTCTATTGTCTATTTTGGGTTCCTACAGTTCATCGGGCAGACATTCAGAAGCGTTTGAGTTACTT
GAATTTTTGAAAGACCACGCCAGTGGATCTAAAAGGCTTATAAACGAAGCTCTAACTGTTCTACATTGCAAGGTTAACAA
TATAAGTGCTGCTCTAGATGAATATTTTGCTGACCCATGTGTTCATGGCTGGTGTTGTGGCAGTTCCACCATGTATGAAA
CTCTATTACACTGCTGTGTAGCAAATGAACATTACGCTGAAGCTTCTCAAATTTTCTCTGACTTGAGACTATCTAGCTGC
GAAGCATCAGAAAGTGTTTATAAAAGCATGGTTGTTGTGTATTGCAAGCTTGGCTTTCCGGAGACAGCTCATCAAGTGGT
TAATCAAGCTGAGACAAAAGGCTTCCACTTTGCTTGTTCGCCTATGTATACTGATATGATTGAGGCTTATGGAAAGCTAA
AGCTATGGCAGAAAGCGGAGAGTGTGGTTGGAAACCTAAGACAAAGTGGACGAACACCTGATCTGAAGACATGGAACAGC
TTAATGTCGGCTTATGCTGAGTGTGGCTGTTACGAGCGGGCAAGGGCTATTTTTAACACTATGATGAGGGATGGTCCGCC
TCCTACTGTTGAATCCATCAATATCTTGTTGCATGCTTTGTGTGTTGATGGAAGACTTGAAGAGCTCTACGTTGTTGTTG
AAGAATTGCAAGATATGGGCTTTAAGATTAGTAAAAGCTCCATTCTTTTGATGCTTGACGCATTTGCCCGGGCTGGAAAT
ATCTTTGAGGTAAAGAAGATATACAGTAGCATGAAAGCTGCTGGTTACTTACCCACGATTCGCCTTTATAGGATGATGAT
TGAGCTTCTCTGCAAAGGGAAACGAGTTAGAGATGCTGAAATTATGGTCTCTGAAATGGAAGAGGCCAATTTCAAGGTTG
AGCTCGCTATATGGAATTCCATGCTGAAGATGTATACTGCTATCGATGATTACAAGAAGACAGTTCAAGTATATCAGAGG
ATAAAAGAAACCGGACTGGAACCAGATGAGACCACTTACAATACTCTGATTATAATGTATTGTAGAGACAGACGACCAGA
AGAAGGGTACTTGCTTATGCAGAAAATGAGAAATATTGGTCTGGACCCAAAACTGGACACATACAAGAGCTTAATCTCTG
CCTTTGGCAAGCAAAAATGCCTTGAACAAGCTGAACAACTGTTTGACGAGCTTCTCTCCAAAGGTTATAAACTAGACCGT
TCATTTTACCACACGATGATGAAAATATCCCGAGATTCTGGAAGTGAGTTTAAGGCAGAGAAATTGTTGCAAATGATGAA
GAATGCGGGAATAGAACCAACACTTGCTACAATGCATTTGCTTATGGTTTCATATAGTTCTTCAGGAAAGCCCCAAGAAG
CTGAAAAAGTTCTTAGTAACCTGAAAGAAACAGACGTGGAACTAACAACTCTGCCTTATAGCTCAGTTATTGATGCTTAC
CTTCGGAGCAGAGATTATAATAGTGGAATAGAAAGGCTTTTGGAAATGAAAAAAGAGGGCCTGGAACCAGACCACAGGAT
ATGGACTTGCTTTGTTAGGGCAGCGAGTTTCTCCAAGGAAAAAAGTGAAGTCATATTGCTGTTGAAAGCTCTTCAAGATA
TTGGTTTTGATCTTCCTATCAGGCTTTTAGCTGGAAGAGCTGAGTTGTTAGTGCCTGAGGTGGATGGATGGTTCGAGAAA
CTGAAACCCATTGAGGACAATGCTGCTCTCAATTTTGCCAATGCTCTTTTAAATCTTCTATGGGCATTTGAACTCAGAGC
TACTGCTTCATGGGTATTCCAATTGGCAATCAAAAGGGATATCTTCAGTCGCGATGTTTTTAGGGTGGCGGACAAAGACT
GGGGTGCTGATTTTAGAAGATTGTCGGGAGGTGCAGCACTTGTTGCCCTGACTCTATGGCTTGACCACATGCAGGATGCA
TCACTTGAAGGGTACCCGGAGTCTCCAAAGTCAGTTGTCTTAATCACAGGGACCGCAGAATACAACGGTATATCCCTGGA
CAAAACGCTAAAGGCATGTCTCTGGGAGATGGGTTCTCCATTTCTTCCCTGCAAGACGAGAACCGGACTTCTAGTGGCCA
AAGCTCACTCTCTGAGAATGTGGTTGAAGGACTCACCATTCTGCTTCGACTTGGAGCTAAAAGACTCGGTGTTGTTACCA
GAATCAAACTCGATGGACCTGATCGACGGGTGTTTCATAAGACGTGGACTTGTTCCTGCGTTTAACCACATCAAAGAGAG
ACTTGGAGGGTTTGTGTCACCAAAGAAGTTTTCAAGACTGGCATTGCTACCAGACGAAATGAGAGAACGAGTGATAAAGA
GAGATATAGAAGGACATAGACAGAAGTTAGAGAAGATGAAGAAGAAGAATAAGGGAAATGAAGTGATTAGTGTTAACACT
CGAAGGAAGTTCGTCAGAAGTAAGTGA