Details for Capsella Locus Carubv10012796m

Position : scaf_3 ( 5`- 6793505 .. 6802666 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012796m

Protein [Map View]
RDDESLFNTQKKLVASFSYSLLRNHRGQLHVTIPSQTLKFPIKSQIKGAGEQKKMVFTWNNIAKSAEQVFSRWAVKRVVK
FLLKKKLGKLILGDIDLDQLDIQLRDGTIQLCDLAINVDYLNDKFDAPLLIKEGSIGSLLVKIRWETNGCQVEVDELELV
LAPRLESNASSSNEATTSASTREDSHNVRLELGKHDNEMLVNAAKSASIDVHEGVKTVAKIVKWFLTSFHAKIKNLIIAF
DPDFGTDRNEAGPRPTLVLRMTEIDCGISEDHVSADEVSHDNILGINRLANCVKFQGAVVELLNMHDDDDDDKTCGKKSS
SGVTLIMTGEGGGFSGNLNFSIPWKNGSLDIRKVDADICIDPVEVRIQPSTIRWFLQLWKTFTSFGSNCCPSVPHSDSAT
DSLTIPTNVIVMPPATLSLSGGQELEPDTTPELQFIPDWFPSSFSKKEVDGEVDIGASVDQFFECFDAMRSYQSAFGSQG
MWNWTSSVFTAINAASSLASGSLLLPSEQHVETSCKVSFAGVSVVLFFQDEDNWKDVSMRIHYLGAELRDISVSFQVCPH
DMRLEGKVKSMEIADYIQAGNVVDTANAEYQTRLIKDLQAKVQTSLPPFASSDRHADSESLLEIVSDGFLFRNKGVAVKT
LLVMAAGGSGFQFIVSFQSSKSSHRVSNSFSLSLPPTTFWLNLNSVEMLVNLFSNISESIPITSHERIQVASSSKSDNLR
GSVSIWNARVILCFPFESNSERLCNSLGEQFIVVDLSSSLPSDKERRKEESPGEMYFTSATRSICFNVGDASIYLVTSDR
KDSEQNSCHRPGEFSAYNILHTNNRTRHQLSTIGIFWQDRPIGSPWLVERAKMLATQEESIQTGKSGGNGLEFAAVATAK
DQEDIYSQTRKEIMLASSFCLFVHLLPLAIRLDSWQYSKFCNLVEEAKNWLSRMAANTAEKTEEPVVCQTSLVVECDSID
ILVRPEPRTDIKNQLQIELPGSWIQLNLRVQKVNLMSVSNLGSISGADFFWLAHGEGTLWGSVTGLPDQEFLLLSCNNSA
IKRGNGGGSNALSSRFAGLDILHLQEPGISHDYLAVSARGCTISAIGGRLDWIEVASSFFTFEVETNSKERNSSSSSGSS
FILNLVDVGLSYEPHLENTDHLHQASDPWVACLLAASSFSLSKTSLVDSLSNDYRIRIQDLGLLLSVDLDLSKLDGVYSS
EHLHETGYVKVANVALIEATLKTHSEHGLLWELECSKTHLLIETCSDTTSGLIRLATQLQQLLAPDLEESAVHLQTRWDS
IQQANARNDFEISDRLSSSDSSGEMKNFRLESENETGAIGLMDEINEDAFQFDVNSTCQSDSMECQNNYMSPHGISHGQA
YNWVPEKLPSNHSFCGSSSRIDSESSQIFLERESLPEIIENYCLSELRPLSDVPKEGDSSGRELFPETDLRRGNSGWYDD
TSVRILEDHVSEATEEDHEEHILDGDFSSCGLTSYSSVAANGRIVLKNIDLKWRIYSGSDWHDSRKKGENFKHTKGRDTT
SSLELELSGVQFLYEIFPIGGICTSKFSLKVQDFYLYDRSNTAPWTLVLGYFNSRDHPRDSSSNAFKLELKAVRPDPETP
LEENRLRVALLPILLHLHQSQLDFLISFFGANSLEKSAVSIGDSGGSTLSVSVKGHNIIEEALLPYFQKFDIWPVSVRVD
YSPHHVDIAALTGGKYAELVNLVPWKGIELQLKHVHAAGIYGWGNVCETILGEWLEDVSQNQIHQLLKGIPTVRSLAALY
AAAAKLVSSPVESYRKDRRLVKGVQRGTITFLRSISLEAVGLGVHLAAGAHDILLRAEYIFASAPSLAQPQGKTKTNVRH
NQPRNAKQGMLKACENIGDGIGKTASALVRTPLKKYQRGDGAGSAFATVVQGVPTAAIAPASACARAVHSALVGIRNSLD
PEHKKESMEKYLGPDKQRKQDQHR*

DNA
AGAGACGACGAAAGTCTCTTTAATACTCAAAAAAAACTTGTTGCTTCCTTCTCTTATTCTCTCCTCCGCAATCACAGAGG
ACAACTTCATGTCACCATCCCCTCACAAACCCTAAAATTCCCAATCAAATCCCAAATTAAAGGCGCAGGGGAACAAAAGA
AGATGGTGTTTACGTGGAACAACATTGCTAAATCCGCGGAGCAAGTTTTTTCGAGGTGGGCGGTGAAGAGGGTTGTCAAA
TTCTTGTTGAAGAAGAAATTGGGTAAACTCATACTTGGTGACATCGACCTTGATCAGCTCGATATTCAGCTTCGTGATGG
CACAATTCAGCTCTGCGATCTTGCTATCAACGTTGACTATTTGAATGACAAGTTTGATGCTCCGCTGCTCATAAAGGAAG
GTTCGATTGGATCTTTGTTAGTTAAAATTCGTTGGGAGACCAATGGTTGTCAAGTTGAGGTTGATGAGCTTGAGCTTGTT
CTCGCACCACGTTTGGAAAGTAATGCATCATCTTCAAATGAAGCCACCACCTCTGCCTCTACCCGAGAAGATTCTCATAA
TGTTCGTCTCGAATTAGGAAAACATGACAATGAGATGTTGGTGAACGCTGCCAAATCTGCGTCTATCGATGTACATGAAG
GCGTTAAGACGGTTGCAAAGATAGTGAAATGGTTTCTTACAAGTTTTCATGCCAAAATTAAGAATCTGATAATAGCATTT
GATCCCGATTTTGGCACAGATCGGAATGAAGCTGGTCCTAGGCCAACACTGGTACTTAGAATGACAGAAATAGACTGTGG
AATTTCAGAGGATCATGTTTCGGCTGATGAAGTTTCTCATGACAATATACTCGGTATTAATCGACTTGCAAACTGTGTGA
AGTTTCAAGGAGCTGTTGTAGAGCTTTTAAATATGCATGATGATGATGATGACGACAAAACTTGTGGTAAAAAATCATCA
AGTGGTGTCACTTTAATCATGACAGGCGAAGGAGGTGGCTTTTCAGGGAATTTGAATTTTAGTATACCCTGGAAGAATGG
TTCTTTAGACATTCGCAAGGTGGATGCTGATATTTGTATTGATCCTGTTGAAGTACGAATTCAACCATCTACAATTAGAT
GGTTCTTACAATTGTGGAAGACTTTCACGAGTTTTGGATCAAACTGTTGCCCCTCAGTTCCTCATTCTGATTCAGCGACT
GATTCACTTACAATACCTACTAATGTAATAGTAATGCCTCCAGCTACATTATCCTTGTCAGGTGGCCAAGAATTAGAGCC
TGATACTACACCTGAATTACAGTTTATACCGGATTGGTTTCCATCTTCGTTCAGCAAGAAAGAAGTGGATGGAGAAGTAG
ATATCGGGGCAAGTGTGGACCAGTTTTTTGAATGTTTTGATGCAATGAGGAGTTACCAATCAGCTTTTGGAAGCCAAGGA
ATGTGGAATTGGACATCTTCTGTCTTCACAGCAATCAATGCTGCATCTAGCCTCGCTTCTGGATCTTTGCTTCTTCCTTC
TGAACAACATGTTGAAACAAGTTGTAAAGTATCCTTTGCTGGAGTTTCGGTGGTATTATTTTTCCAAGATGAAGACAATT
GGAAGGATGTTTCCATGCGGATTCACTACTTGGGTGCAGAACTCAGAGATATTTCTGTCTCTTTTCAGGTATGCCCTCAT
GATATGAGGCTAGAAGGAAAAGTGAAAAGCATGGAGATCGCCGATTATATTCAAGCTGGAAATGTTGTTGACACTGCTAA
TGCTGAATATCAGACTCGTTTGATTAAGGATTTACAAGCCAAGGTTCAGACTAGTCTTCCTCCCTTTGCCTCGTCTGATA
GGCATGCTGACTCCGAAAGCTTACTCGAGATAGTTTCTGATGGATTCCTCTTTCGTAACAAGGGTGTTGCAGTCAAGACA
TTGTTGGTTATGGCTGCAGGAGGCAGTGGATTTCAGTTTATTGTCAGTTTCCAATCATCCAAATCCAGCCATAGAGTATC
AAACTCATTCTCGTTGAGTTTACCACCTACCACATTCTGGTTGAACCTTAATTCAGTAGAAATGTTGGTAAATCTTTTCA
GCAATATATCAGAATCTATCCCCATAACTAGTCATGAAAGGATTCAGGTGGCATCCTCTTCTAAATCAGATAATTTGCGA
GGTAGTGTGTCAATCTGGAATGCTCGAGTTATTCTGTGTTTCCCTTTTGAGAGTAATTCAGAAAGGTTATGTAACTCGCT
TGGTGAGCAATTTATTGTCGTCGACTTATCTTCCTCTCTGCCATCTGACAAGGAAAGGCGTAAAGAAGAAAGTCCAGGAG
AAATGTATTTTACATCGGCTACTCGCTCTATATGCTTCAATGTTGGTGATGCTAGCATCTATTTGGTCACGTCTGACCGT
AAAGATTCTGAACAAAATTCATGCCATAGGCCGGGTGAATTCTCTGCATATAATATTTTACATACCAACAATAGAACTAG
GCACCAACTTTCAACCATTGGTATATTTTGGCAAGATCGACCTATTGGTAGTCCTTGGTTAGTAGAGAGAGCTAAGATGT
TGGCTACGCAGGAAGAATCTATTCAGACAGGTAAATCTGGGGGGAACGGCCTTGAGTTTGCTGCTGTTGCTACGGCCAAA
GATCAAGAAGACATCTACTCTCAAACCAGGAAAGAAATAATGTTGGCTTCTTCATTCTGCCTTTTTGTTCATTTGCTTCC
ACTTGCTATCCGTTTAGATAGTTGGCAATACAGCAAATTCTGTAATCTCGTAGAAGAGGCAAAAAATTGGCTATCACGTA
TGGCAGCCAATACAGCTGAGAAAACAGAGGAACCTGTTGTGTGTCAAACGTCTCTTGTTGTTGAATGTGATTCTATTGAC
ATCTTGGTTAGGCCAGAACCACGAACGGACATTAAAAATCAGCTTCAGATTGAGCTTCCTGGATCATGGATTCAGCTCAA
CCTAAGGGTTCAGAAAGTAAATCTTATGTCTGTCTCAAATCTCGGTAGTATCTCTGGTGCTGATTTCTTTTGGTTAGCCC
ATGGGGAAGGTACATTATGGGGTTCTGTTACAGGTCTACCTGATCAGGAGTTTCTCTTACTCTCATGTAATAACTCTGCA
ATCAAGCGCGGTAATGGAGGAGGTTCAAACGCTTTGTCGTCAAGATTTGCTGGCTTAGATATTCTGCATTTACAAGAACC
AGGAATTAGTCACGATTATTTAGCAGTATCTGCCAGGGGCTGTACGATCTCTGCCATAGGAGGACGCCTGGATTGGATAG
AAGTAGCTAGTTCTTTTTTCACTTTTGAAGTTGAAACAAATTCTAAAGAGAGAAACTCCAGCTCATCTAGCGGCTCCTCG
TTTATTCTGAATTTAGTTGATGTTGGTCTAAGCTATGAGCCCCACCTTGAGAATACAGATCATTTACATCAAGCAAGTGA
TCCATGGGTTGCCTGTCTGCTAGCAGCATCTTCTTTTAGCCTCTCGAAGACAAGTCTGGTTGATTCCTTAAGCAATGATT
ATAGAATCAGGATTCAAGATCTTGGGCTTCTTCTGTCTGTGGATTTGGACCTTAGCAAACTTGATGGAGTGTACAGTTCA
GAGCATCTTCATGAGACTGGCTATGTTAAAGTTGCTAATGTGGCTCTAATTGAAGCAACTCTAAAGACTCACTCTGAACA
TGGCCTTCTTTGGGAGTTAGAGTGTTCAAAAACTCACTTATTAATTGAAACTTGCAGTGACACAACTTCTGGTTTGATTC
GCTTGGCCACCCAGCTCCAACAGTTACTTGCTCCTGATTTGGAGGAATCAGCTGTGCACCTGCAGACTCGATGGGATAGC
ATTCAGCAGGCAAATGCTAGGAATGATTTTGAGATCAGCGATAGACTCAGTAGCTCTGATTCAAGTGGAGAAATGAAAAA
TTTCAGATTAGAGTCAGAAAATGAAACTGGGGCCATTGGTTTGATGGACGAAATAAATGAAGATGCATTCCAATTTGATG
TCAATTCTACATGTCAGTCTGACTCCATGGAATGTCAGAACAATTATATGTCACCTCATGGAATCTCTCATGGGCAGGCC
TATAATTGGGTACCTGAGAAATTACCTTCTAATCACAGTTTTTGTGGGTCGTCATCTAGAATAGATTCAGAAAGTAGTCA
AATTTTTCTAGAAAGAGAGAGCCTGCCTGAAATAATTGAAAACTATTGTTTGTCTGAGCTCCGTCCATTGTCAGATGTAC
CTAAAGAAGGGGATTCATCAGGGAGAGAATTGTTTCCTGAGACTGATTTGAGGAGAGGAAATTCTGGGTGGTATGATGAC
ACGTCCGTAAGAATTTTAGAAGACCATGTGTCAGAAGCAACTGAGGAAGATCATGAGGAACATATTCTTGATGGAGACTT
TTCATCTTGTGGCCTGACGTCTTACTCTTCTGTAGCTGCTAATGGACGTATAGTTCTGAAAAACATTGACCTCAAATGGA
GAATTTATTCTGGCTCTGATTGGCATGATTCTAGAAAGAAAGGTGAAAATTTTAAACATACAAAGGGTCGGGATACAACT
TCGAGCCTTGAGCTGGAATTATCTGGGGTGCAGTTCCTGTATGAAATCTTTCCAATTGGCGGAATATGTACCTCTAAATT
TTCTCTCAAGGTCCAAGATTTTTATCTTTATGATAGAAGCAACACTGCACCTTGGACATTGGTCCTTGGATATTTTAACT
CACGAGATCACCCAAGAGATTCCTCTTCAAATGCATTCAAGTTGGAATTAAAAGCTGTCAGACCTGACCCTGAGACGCCA
CTTGAGGAAAATAGGTTACGGGTCGCTTTACTCCCTATACTCTTACATCTTCATCAAAGTCAACTGGATTTTCTCATCAG
CTTCTTTGGAGCTAACAGCCTAGAAAAGTCTGCCGTCTCAATTGGAGACTCGGGCGGTTCAACGTTGTCGGTTTCTGTTA
AAGGACATAATATCATAGAAGAAGCACTTCTTCCATATTTCCAGAAATTCGACATATGGCCTGTTAGTGTTCGAGTTGAT
TACAGTCCCCATCATGTTGATATAGCAGCGCTAACCGGAGGGAAATACGCAGAGCTTGTGAACCTTGTTCCATGGAAGGG
GATTGAATTACAGCTCAAACATGTGCATGCTGCTGGAATCTATGGCTGGGGAAATGTATGTGAGACTATACTGGGAGAAT
GGTTGGAAGATGTATCTCAGAATCAGATTCATCAACTGTTAAAGGGGATTCCCACAGTAAGATCACTTGCTGCTCTTTAT
GCTGCTGCTGCAAAGCTGGTCTCATCACCTGTCGAAAGTTACAGGAAAGATCGAAGGCTAGTGAAGGGAGTTCAAAGAGG
TACTATAACGTTTCTCAGAAGCATCTCACTGGAAGCTGTTGGACTTGGTGTTCACTTGGCAGCTGGGGCTCATGATATTT
TATTGAGAGCAGAATATATATTTGCAAGTGCACCATCATTGGCACAACCCCAAGGCAAAACGAAGACGAATGTTAGGCAT
AATCAGCCTAGAAATGCTAAGCAAGGCATGCTTAAGGCATGTGAGAACATTGGTGATGGAATAGGAAAGACAGCTTCTGC
ATTAGTCCGCACACCTTTGAAGAAGTATCAACGTGGAGATGGAGCTGGGTCAGCTTTTGCAACAGTTGTTCAGGGAGTTC
CAACAGCTGCTATAGCACCTGCTTCAGCTTGTGCTAGAGCAGTACATAGTGCTCTTGTTGGCATTAGAAATAGTCTTGAT
CCTGAACATAAAAAGGAATCAATGGAAAAGTACTTAGGCCCCGATAAACAAAGGAAGCAGGACCAACACCGATAA