Details for Capsella Locus Carubv10012791m

Position : scaf_3 ( 5`- 13567041 .. 13585009 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012791m

Protein [Map View]
MSPIQNFEQHSRRLVDPDLPIQTRLEMVVEVRDSLEIAHTAEYLNFLKCYFPAFSVILLQITKPQFMDNPEHKLRNIVVE
ILNRLPHSEVLRPFVQDLLKVAMQVLTTDNEENGLICIRIIFDLLRNFRPTLENEVQPFLDFVCKIYSIFRFTVSHFFDN
VKMEEVKPLETPTSSDQSLTPSAPIGNGQLNPSTRSFKIITESPLVVMFLFQLYSRLVQTNIPHLLPLMVAAISVPGPEN
VPSHLKPQFIELKGAQVKTVSFLTYLLKSCAEYIRPHEESICKSIVNLLVTCSDSASIRKELLVSLKHVLGTDFKRGLFP
LIDTLLDERVLVGTGRACFESLRPLAYSLLAEIVHHVRGDLSLAQLSRIIYLFSRNMHDSTLSLSIHTTCARLMLNLVEP
IFEKGVDQQSMDEARILLGRILDAFVGKFSTFKRTIPQLLEEGEVGKDRVTLRSKLELPVQAVLNLQVPVEHSKEVNDCK
NLIKTLVMGMKTIIWSITHAHLPRPQGMNPQALVSQSSAPQGFKGMREDEVWKASGVLKSGVHCLALFKEKDEEKEMLNL
FSQILAIMEPRDLMDMFSLCMPELFESMINNNQLVQIFAALLQAPKVYKPFADVLINLLVSSKLDVLKNSDSAATKLVLH
LFRCIFGAVTKTPSDFERILQHHVPVIMEVCMKNATEVEKPLGYMQLLRTVFRGLAGCKYELLLRDLIPMLLPCLNLLLT
MLEGPAGEDMKDLLLELCLTLPARLSSLLPYLPRLMKPLVFCLRGGDELVSLGLRTLEFWVDSLNPDFLEPSMANVMSEV
ILALWSHLRPVPYPWGKKALQILGKLGGRNRRFLKEPLTLECKDNPEHGLRLVLTFEPSTPFLVPLDKFINLAVAAVIQR
NQGMDIYYRKQALKFLRVCLLSQLNLPGCVTDLGQTPRQLSTLLRSSVDSSWHRSESVEIKADLGVKTKTQLMAEKSIFK
TLLITILAASSDPDLSDTDDDFVENICRHFAIILHVDYTSSNASTSTSSLGGSMISASSRSKSNQSSNLKQLDPLIFLDA
LVDVLADENRLHAKAALNALNVFAETLLFLARVKHADVLMARGGHNASMIVSSPSTNPVYSPHPSVRIPVFEQLLPRLLH
GCYGSTWQAQMGGVMGLGALVGKVNVETLCNFQVKIVRGLVYVLKRLPVYASKEQEETSQVLMQILRVVNNVDEANSEAR
RKSFQDVVEYLATELFNPNASIPVRKNVQNCLALLASRTGSEVTELLEPLYQLLLQPLIMRPLRSKTVDQQVGTVAALNF
CLALRPPLLKVTPELVNFLQEALQIAEADETVWAVKLMNPKVLTSLNRLRTACIELLCTTMAWTDFRTQTQNELRAKIIS
MFFKSLTCRAPEIVAVAKEGLRQVINQQRMPKELLQSSLRPILVNLAHTKNLSMPLLQGLARLLELLSNWFNVTLGGKLL
EHLKKWLEPEKLAQSQKSWKAGEEPKIAAAIIELFHLLPHAASKFLDELVTLTIDLEAALPLGQVYSEINSPYRLPLTKF
LNRYAALAVDYFLSRLSEPKYFRRFMYIIRSDAGQPLREELAKSPQKILSCAFPEILPKPDPTLGTTASTPPAPSSGDEN
HIKLESSNVASTKAYVASDAYFQGLYLIKTMVKLIPSWLQSNRSVFDTLVLIWKSPARISRLQNEQELNLVQVKESKWLV
KCFLNYLRHEKSEVNVLFDILSIFLFHSRIDYTFLKEFYIIEVAEGYPSNMKRALLLHFLNLFHSKQLGHDHLVQAMQML
ILPMLSHAFQNGQTWEVIDPDIVKTIVERLLDPPEEVSAEYDEPLRIELLQLATLLLKYLQSDLVHHRKELIKFGWNHLK
REDSASKQWAFVNVCHFLDAYQAPEKIILQVFVALLRTCQPENKMLVKQALDILMPALPKRLPLGDSRMPIWIRYTKKIL
VEEGHSIPNLIHIFLLVVRHSDLFYSCRAQFVPQMVNSLSRLGLPYNTTAENRRLAIELAGLVVSWERQRQNEMKMVTDT
DGTSQITDELHTSSSADPKRSTDGSATSEDPSKRVKIEPGLQSICVMSPGGPSSIPNVETPGSATQPDEEFKPNAAMEEM
IINFLIRVALVIEPKDRETNTMYKQALDLLSQALEVWPNANVKFNYLEKLLSSMPPSQSDPSTALAQGLDVMNKVLEKQP
HLFIRNNISQISQILEPCFKHKMLDAGKSLCSLLKMVFTAFPLDAVNTPPDIKLLYQKVNELINKHVNTVTAPQASGDDN
SFGSISFVLLVIKTLAKVHKNFVDSYVLVRILQRLARDLGSAVGSNPRQGQRPDSDSAVTSSRQTADVGAVICNIKSVLE
LIDETVMLIADCKRSVTQILNTLLSEKGTDASVLLCILDMIKRWVEDDFSKTGTSGVSGSFLTQKDVVTFLNKLSYIDKQ
HFSSDALEEWDQKYLQLLYGLCADSTKYPLGLRQEVSLKVERHYMLGLRASDPEMRRKFFLLYHESLGKNLFARLQYIIQ
IQDWEALSDVFWLKQGLDLLLAILVEDKPISLAPNSARVLPLLPSDNPGIQQQAPSNLEGSEEVTAMFDSIVMKHAQFLS
ATSKLQVADVVIPLRELAHTDANVAYHLWVLVFPIVWVTLLKEEQVALAKPMISLLSKDYHKKQQGHRPNVVQALLEGLQ
LSHPQPRMPSELIKYIGKTYNAWHLALALLESHVMLFMNDSKCAESLAELYRLLNEEDMRFGLWKKRSITAETRAGLSLV
QHGFWQRAQSLFYQAMVKATQGTYNNTVPKAEMCLWEEQWLHCASQLSQWDALVDFGKSIENYEILLDSLWKLPDWAYLK
DHVIPKAQVEETPKLRLVQSYFALHDRNSNGVGDAENTVGKGVDLALEQWWQLPEMSVHARVPLLQQFQQLVEVQESARI
HVDIANGNKVSGNVAAGGLGNRYADLKDILETWRLRTPNEWDNMTVWYDMLQWRNEMYNVVIDAFKDFATSNSPLHHLGF
RDKAWNVNKLARIARKQGLYDVCVQILEKMYGHSTMEVQEAFVKIREQAKAYLEMKGERASGLNLINSTNLEYFPDKIKA
EIFRLKGDFHLKLNDTESANIAYSNAITLFKNLPKGWISWGSYCDMAYQETQEEIWLEYAVSCFLQGIRFGVSNSRSHIA
RVLYLLSFDTANEPVGRVFDKHLDQVPHWVWLSWIPQLLLSLQRTEAPHCKLVLLKIAAVFPQALYYWLRTYLLERRDAV
NKSELGRLVRMQQNASGASAGQGGSNLPAETQIHQGAQISGASGTHDSGNAHGQESDRSTGENNVHPGSDQPMHQSSSAI
NDNNENTVRRNGASLTISAAGAFDAAKDIMEALRGKHNNLASELEVLLTEIGSRFVTLPEERLLAVVNALLHRCYKYPTA
TTAEVPQPLKKELSGVCRACFSADAVTKHVEFVKEYKQDFERHLDPESTATFPVTLAELTARLKKWKNILQSNVEDRFPA
VLRLEDESRVLRDFNVVDVEIPGQYFADQEVAPDHTIKLDRVGADVPIVRRHGSSFRRLTLIGSDGSQKHFIVQTSLTPN
ARSDERILQLFRVMNQMFDKHKESRRRHIGIHTPIIIPVWSQVRMVEDDLMYNTFLEVYENHCARNDREADLPITHFKEQ
LNQAISGQISAEAIGDLRLQAYVDITKTLVNDSIFSQYMYKTLMSGSHMWAFKKQFAVQLAVSSFMSFMLQIGGRSPNKV
LFAKNTGKMFQTDFHPAYDANGMIEFNEPVPFRLTRNMQAFFSQFGVEGLLMSSMCSAAQAVISSKQNEHLRYQLAMFFR
DELLSWFGRRPLGVPIPPVGGIATLNSVDLKHKVNANVEDVIGRIRGIAPQYFSEEDENTVEPPQSVQRGVNELVEAALS
PRNLCMMDPTWHPWF*

DNA
ATGAGTCCAATTCAGAACTTCGAGCAACACTCCCGTCGTCTCGTGGATCCTGACCTGCCTATTCAAACAAGGCTTGAGAT
GGTGGTGGAGGTCAGGGACAGTCTAGAGATAGCGCATACGGCTGAGTACTTGAATTTCTTAAAATGCTACTTCCCAGCAT
TCTCAGTTATTCTTCTACAGATTACGAAACCGCAATTCATGGATAATCCGGAGCACAAATTAAGGAATATTGTGGTTGAG
ATCCTCAATCGTCTTCCCCACAGTGAGGTTCTTCGTCCCTTTGTTCAGGATCTCTTAAAGGTTGCAATGCAGGTGCTCAC
CACAGACAATGAAGAAAACGGGTTAATTTGCATTCGCATAATCTTTGACCTTCTTAGGAACTTTAGGCCCACACTAGAAA
ATGAGGTTCAACCCTTTTTAGACTTTGTCTGCAAGATCTATTCGATTTTCAGATTCACTGTCAGCCATTTTTTCGATAAT
GTTAAAATGGAAGAGGTGAAGCCTTTGGAGACGCCTACATCTTCTGATCAATCCCTTACTCCTTCCGCACCTATTGGGAA
TGGGCAGCTTAACCCAAGTACTCGGTCATTCAAGATCATCACAGAGAGCCCCCTTGTTGTTATGTTCCTTTTCCAGCTGT
ATAGCCGACTCGTTCAGACCAACATTCCTCATTTACTTCCCCTGATGGTTGCTGCTATATCTGTCCCTGGACCTGAGAAT
GTCCCTTCACATTTGAAGCCTCAGTTCATAGAGTTGAAGGGTGCACAGGTTAAGACGGTTTCTTTTTTGACTTATTTGTT
AAAAAGTTGCGCTGAATATATCCGACCCCATGAAGAGAGCATATGTAAAAGCATTGTAAATTTGCTTGTGACTTGTTCAG
ATTCTGCATCTATCAGAAAGGAACTCTTAGTCTCATTAAAGCATGTACTTGGGACGGATTTCAAGAGAGGCTTATTTCCT
CTTATTGACACTCTTTTAGATGAGAGGGTTCTAGTTGGAACTGGGCGAGCATGTTTCGAGTCTTTGAGGCCTTTGGCATA
CAGCCTACTAGCAGAGATTGTTCACCATGTTCGCGGAGATCTTTCTCTTGCTCAGTTATCACGGATTATATACCTATTTT
CAAGAAATATGCACGACTCGACCCTCTCTCTTAGCATCCATACGACATGTGCCCGGCTAATGCTGAATCTGGTAGAACCA
ATATTTGAGAAAGGGGTTGATCAGCAGTCGATGGATGAAGCACGGATTTTGCTGGGACGTATCCTGGATGCCTTTGTGGG
GAAATTCAGTACTTTCAAGCGTACTATTCCTCAGCTTTTGGAGGAGGGTGAGGTGGGAAAGGATCGGGTCACTTTGAGGT
CTAAGCTTGAACTTCCTGTTCAGGCAGTTTTGAATTTGCAGGTTCCTGTTGAACATTCCAAAGAAGTGAATGATTGTAAG
AATTTGATCAAGACACTGGTCATGGGAATGAAAACAATAATATGGAGTATAACCCATGCACATTTGCCTCGACCTCAGGG
GATGAACCCTCAAGCTCTTGTTTCACAATCATCTGCTCCGCAGGGTTTTAAAGGAATGAGAGAAGATGAGGTGTGGAAAG
CCTCTGGTGTTTTAAAGAGTGGTGTCCACTGCTTAGCTCTCTTCAAAGAGAAGGATGAAGAGAAGGAAATGCTTAATCTT
TTCTCCCAGATTCTTGCTATTATGGAACCTCGTGATCTAATGGACATGTTCTCTTTATGCATGCCAGAGCTTTTTGAGAG
CATGATTAACAACAACCAACTGGTTCAGATATTTGCAGCACTTCTGCAAGCTCCCAAAGTTTACAAGCCATTTGCAGATG
TTTTGATTAATTTACTAGTTAGCAGCAAACTTGATGTTCTGAAGAATTCAGATTCAGCTGCAACTAAACTAGTTTTGCAT
CTGTTTAGATGCATCTTTGGGGCTGTCACCAAGACACCATCTGATTTTGAAAGAATATTACAGCATCACGTGCCTGTTAT
TATGGAAGTCTGCATGAAGAATGCTACAGAAGTTGAAAAACCACTTGGTTATATGCAATTGCTCCGCACTGTTTTCAGAG
GTCTTGCTGGATGTAAATATGAACTACTTTTGAGAGATTTGATCCCCATGCTGCTACCTTGTCTTAATCTTCTTCTGACA
ATGCTAGAGGGTCCAGCTGGAGAGGACATGAAAGATCTTTTGTTAGAGCTTTGTTTGACGCTTCCTGCACGCTTAAGCTC
CTTATTGCCATACCTTCCCCGTCTCATGAAGCCTCTCGTATTCTGTTTGAGGGGAGGCGATGAACTTGTGAGCTTGGGGT
TACGCACCCTTGAATTCTGGGTGGACAGTCTGAATCCTGATTTCCTGGAACCTAGCATGGCGAATGTGATGTCTGAAGTG
ATCTTAGCATTATGGTCTCATTTGAGGCCTGTGCCATATCCTTGGGGTAAGAAAGCCTTACAAATCCTTGGAAAGTTGGG
TGGTCGCAACCGAAGATTTCTGAAAGAGCCACTTACACTTGAATGCAAAGATAATCCAGAGCACGGGCTTCGCTTAGTTC
TGACATTTGAGCCATCGACACCTTTTCTCGTGCCACTAGACAAATTTATTAATCTTGCTGTTGCAGCTGTTATTCAGAGA
AATCAGGGCATGGATATATATTACAGAAAGCAAGCCCTTAAATTCCTCCGAGTATGCTTATTGTCCCAGCTTAATTTGCC
TGGATGTGTCACTGATCTGGGTCAAACGCCCAGGCAATTATCAACGTTGTTACGTTCGTCTGTTGATTCATCTTGGCACA
GGAGTGAATCAGTGGAAATCAAGGCTGACTTAGGAGTGAAAACAAAGACTCAGTTAATGGCTGAAAAGTCGATCTTCAAG
ACACTGTTGATCACTATACTTGCTGCCAGTTCTGATCCAGATCTCAGTGACACAGACGATGACTTTGTTGAAAACATCTG
TCGGCATTTTGCAATTATTTTGCATGTTGACTATACCTCCTCAAATGCATCAACTAGTACTAGTTCACTCGGTGGTTCTA
TGATTTCGGCAAGTTCCAGATCCAAGAGTAATCAATCATCTAATTTAAAGCAGTTAGATCCTTTGATATTTTTAGATGCA
CTGGTCGACGTGCTTGCAGATGAAAACAGGCTCCACGCCAAAGCTGCTCTGAATGCGTTAAATGTGTTTGCTGAAACACT
TTTGTTCCTAGCTCGTGTCAAACATGCTGATGTGTTGATGGCTAGGGGTGGTCACAATGCCTCCATGATTGTCTCGAGCC
CTTCTACAAATCCAGTATATTCACCTCATCCGAGTGTGCGGATACCAGTCTTTGAACAACTTTTGCCTCGGCTTTTGCAT
GGCTGTTATGGGAGCACATGGCAAGCACAGATGGGAGGGGTTATGGGGCTAGGTGCATTGGTTGGGAAAGTGAATGTTGA
AACATTATGTAATTTCCAAGTGAAGATAGTGCGTGGTCTTGTTTATGTTTTGAAGAGGCTTCCTGTTTATGCTAGCAAAG
AGCAAGAAGAAACAAGTCAGGTTCTTATGCAGATTCTACGTGTGGTTAATAATGTTGATGAAGCAAACAGTGAAGCGCGT
AGAAAAAGCTTTCAAGATGTTGTAGAATATCTTGCCACAGAGTTATTCAATCCTAACGCTTCCATCCCCGTGAGAAAAAA
TGTACAGAACTGCCTTGCACTTTTGGCTAGCCGAACTGGAAGTGAGGTAACTGAGTTGCTGGAGCCTTTGTACCAACTAT
TACTGCAGCCACTTATAATGCGTCCACTCCGATCAAAGACAGTTGATCAACAGGTTGGAACAGTTGCAGCTCTGAATTTT
TGCTTGGCTCTGAGGCCCCCCCTTCTAAAAGTGACTCCAGAGTTGGTTAATTTTCTGCAAGAAGCATTACAGATTGCTGA
GGCTGATGAAACCGTCTGGGCTGTAAAGTTGATGAATCCTAAAGTGCTTACATCATTGAACAGACTTCGAACAGCTTGTA
TTGAGCTTCTCTGCACAACTATGGCGTGGACTGATTTCCGAACGCAAACTCAGAATGAATTACGTGCCAAAATAATTTCC
ATGTTTTTCAAGTCTTTAACATGTAGAGCACCAGAAATCGTGGCGGTTGCCAAGGAGGGTTTAAGACAGGTTATCAATCA
ACAACGGATGCCCAAGGAACTCCTTCAGAGTAGCCTCAGACCAATACTTGTTAATCTGGCGCACACAAAGAATCTCAGTA
TGCCTTTACTGCAAGGTCTGGCACGCCTTCTTGAACTTTTGTCAAATTGGTTTAATGTGACATTAGGAGGCAAGCTGCTG
GAGCACCTTAAAAAATGGTTGGAGCCGGAGAAACTTGCCCAGTCACAAAAATCATGGAAAGCTGGAGAAGAGCCAAAAAT
AGCAGCTGCTATTATCGAGCTCTTCCACTTACTTCCACATGCTGCATCAAAATTTCTAGATGAACTTGTTACCTTAACCA
TTGACTTAGAAGCAGCTCTTCCTCTTGGGCAAGTGTACAGTGAGATCAATAGCCCATACCGTCTACCCCTTACTAAATTT
TTGAATCGATATGCGGCCCTCGCTGTTGATTATTTTCTTTCTAGATTAAGTGAACCAAAATATTTCCGAAGGTTTATGTA
TATAATCCGATCAGATGCTGGGCAGCCGTTAAGAGAAGAACTAGCAAAGTCCCCCCAGAAGATACTGTCATGTGCCTTTC
CTGAGATTTTGCCAAAACCTGATCCTACATTGGGCACGACAGCTTCAACTCCTCCAGCTCCATCATCTGGAGATGAAAAT
CATATCAAATTAGAGAGTTCTAATGTGGCATCAACAAAGGCTTATGTAGCATCGGATGCATATTTTCAAGGACTCTATCT
CATCAAAACAATGGTGAAACTGATACCCAGCTGGTTGCAGAGTAACCGTAGTGTTTTCGATACCTTGGTTCTCATTTGGA
AATCACCTGCAAGGATATCTCGTTTGCAGAATGAGCAAGAGCTGAATTTAGTTCAGGTGAAAGAGAGCAAATGGCTTGTC
AAGTGCTTCTTAAATTACCTACGGCATGAAAAATCTGAAGTGAATGTTCTCTTCGATATTCTCTCCATTTTCTTGTTCCA
TAGCCGCATCGACTACACCTTTTTGAAGGAATTCTACATTATTGAGGTTGCAGAGGGATACCCATCCAACATGAAAAGGG
CACTTCTCCTGCATTTTCTTAACCTTTTCCATTCCAAACAACTCGGCCATGATCATTTAGTTCAAGCAATGCAAATGCTT
ATTCTTCCAATGCTTTCCCATGCTTTCCAAAACGGCCAAACTTGGGAGGTTATTGACCCTGATATAGTCAAAACCATTGT
TGAGAGGCTTCTTGATCCACCGGAAGAGGTTTCAGCTGAATATGATGAACCTTTGAGGATTGAACTTTTGCAATTAGCAA
CTTTGCTTCTGAAATATCTTCAGAGTGACTTGGTTCATCATAGAAAAGAGCTCATTAAGTTTGGATGGAATCATCTCAAA
CGAGAAGATAGTGCCAGTAAACAGTGGGCATTTGTTAATGTTTGTCACTTCTTGGATGCTTACCAGGCTCCTGAGAAAAT
CATTCTTCAGGTTTTTGTCGCGCTTCTTAGGACATGCCAGCCGGAGAATAAGATGTTAGTTAAGCAAGCCCTGGATATTC
TAATGCCAGCTTTGCCTAAAAGGCTACCTCTTGGAGATTCACGCATGCCAATTTGGATAAGATACACAAAAAAAATATTG
GTGGAGGAAGGTCATTCAATTCCAAATTTGATCCACATCTTCCTACTTGTTGTTCGGCATTCAGATCTCTTTTACAGCTG
TAGAGCCCAATTTGTCCCTCAAATGGTGAATTCGTTAAGTCGTCTCGGTTTGCCATATAATACTACTGCAGAGAACAGGA
GGCTCGCTATTGAACTTGCTGGATTGGTTGTCAGCTGGGAAAGGCAAAGACAAAATGAAATGAAAATGGTGACTGATACT
GATGGAACCAGTCAGATTACTGATGAATTGCATACTTCATCTAGTGCTGATCCTAAGCGTTCAACAGATGGATCTGCCAC
ATCAGAAGATCCAAGTAAACGAGTCAAAATTGAACCTGGTCTCCAATCAATCTGTGTTATGTCACCTGGCGGGCCATCAT
CAATCCCCAATGTAGAAACTCCTGGATCTGCTACCCAGCCTGACGAAGAATTTAAGCCAAATGCTGCCATGGAAGAAATG
ATCATTAATTTTCTCATAAGAGTAGCATTGGTAATTGAGCCTAAGGACAGAGAAACCAACACTATGTACAAACAAGCGTT
AGATTTGCTTTCACAAGCTTTGGAGGTTTGGCCGAATGCAAATGTCAAGTTCAACTATTTAGAAAAACTGCTGAGCAGCA
TGCCACCATCTCAGTCAGATCCGTCAACAGCACTTGCTCAGGGATTGGATGTCATGAACAAAGTTCTGGAGAAGCAGCCA
CATCTTTTCATTAGGAACAACATCAGCCAGATTTCACAGATTCTTGAACCGTGTTTCAAACACAAGATGCTCGATGCTGG
TAAATCATTATGCTCCTTGCTGAAGATGGTCTTCACTGCATTCCCACTGGATGCCGTCAATACACCTCCTGATATAAAGC
TACTGTACCAGAAAGTCAATGAGCTAATAAATAAACATGTGAATACTGTTACTGCTCCACAAGCTTCAGGAGATGATAAC
TCGTTTGGTTCAATTAGCTTTGTACTTCTTGTCATCAAAACCTTGGCCAAGGTACATAAAAACTTTGTTGATTCATATGT
GTTGGTGCGTATCCTTCAGCGCCTTGCACGGGACCTGGGATCAGCAGTGGGTTCTAATCCTAGACAAGGTCAGCGACCAG
ACTCGGATTCTGCTGTAACTTCTTCTCGTCAAACTGCTGATGTTGGAGCAGTCATATGTAATATAAAGTCTGTCTTGGAA
CTTATTGATGAAACGGTCATGCTTATAGCAGATTGCAAAAGATCTGTTACTCAAATTTTGAACACATTGCTTTCCGAAAA
GGGTACAGATGCTAGTGTGCTTCTCTGCATACTAGATATGATAAAAAGGTGGGTTGAGGATGATTTCAGCAAAACTGGCA
CATCTGGTGTATCTGGTTCTTTCCTTACCCAAAAGGATGTAGTTACTTTTCTCAATAAGCTATCTTATATTGATAAGCAA
CACTTCTCATCTGATGCTTTGGAAGAGTGGGATCAGAAGTATCTACAGCTGTTATATGGACTTTGTGCTGATTCAACGAA
GTATCCTCTGGGCCTACGACAAGAGGTCTCTCTGAAGGTTGAAAGACATTATATGCTTGGCTTACGGGCAAGTGATCCTG
AGATGAGAAGGAAATTCTTCTTGTTATATCATGAGTCACTTGGAAAAAATTTGTTCGCGCGGTTGCAGTACATTATTCAA
ATTCAGGATTGGGAAGCTTTAAGTGACGTCTTTTGGCTCAAACAAGGTCTTGATCTCCTTCTAGCTATCTTAGTCGAGGA
CAAGCCAATTAGCCTGGCCCCAAATTCTGCAAGGGTATTACCACTTTTACCTTCAGATAATCCTGGAATACAACAACAAG
CTCCTTCTAACTTAGAGGGTTCTGAAGAAGTTACTGCAATGTTTGACAGCATTGTTATGAAGCATGCACAATTTCTGAGC
GCAACCAGCAAACTTCAGGTGGCTGATGTTGTCATCCCTTTAAGGGAGTTGGCTCACACTGATGCTAATGTTGCATATCA
TCTGTGGGTTTTGGTATTTCCAATTGTGTGGGTAACTCTGCTCAAGGAAGAACAGGTCGCATTGGCCAAACCTATGATTT
CTCTACTATCGAAGGACTACCATAAGAAGCAGCAAGGACACCGACCAAATGTTGTGCAAGCACTTCTGGAAGGACTTCAG
TTGAGCCACCCTCAACCTAGGATGCCTAGTGAGCTTATCAAATATATTGGAAAAACTTACAATGCATGGCATCTCGCTTT
GGCGTTACTAGAGAGCCATGTGATGTTGTTTATGAATGACTCAAAATGTGCCGAGTCTCTTGCTGAGCTTTATCGTTTGT
TAAATGAAGAAGATATGAGATTTGGGTTGTGGAAGAAGAGGTCCATCACTGCTGAAACGAGAGCTGGACTTTCATTAGTT
CAGCATGGTTTTTGGCAGCGTGCTCAGAGCCTCTTTTATCAGGCCATGGTGAAGGCAACCCAAGGCACGTATAACAACAC
AGTCCCTAAAGCTGAAATGTGTCTGTGGGAGGAGCAGTGGCTCCACTGTGCCAGTCAGCTTAGCCAATGGGATGCCCTTG
TAGATTTTGGAAAAAGCATTGAGAATTATGAAATACTGCTCGATAGTCTTTGGAAATTACCCGATTGGGCATATTTGAAG
GATCACGTGATACCAAAGGCACAAGTGGAAGAGACTCCGAAGCTCCGTTTGGTTCAATCTTATTTTGCCCTTCATGACAG
AAATTCAAATGGTGTTGGAGATGCTGAAAACACAGTGGGGAAAGGCGTTGATCTTGCCTTGGAACAGTGGTGGCAGTTGC
CTGAAATGTCTGTTCATGCTAGAGTGCCTCTATTGCAGCAATTCCAACAACTAGTTGAGGTTCAGGAGTCTGCCAGAATT
CATGTTGACATCGCAAATGGGAACAAAGTTTCAGGAAATGTTGCAGCTGGTGGACTTGGAAATCGTTATGCAGATCTGAA
GGATATTCTTGAGACTTGGAGGCTGAGGACTCCAAATGAATGGGATAATATGACAGTCTGGTACGATATGCTACAGTGGA
GGAATGAAATGTATAATGTTGTTATCGATGCATTTAAGGACTTTGCTACTTCAAATTCTCCACTTCATCACCTTGGTTTC
CGTGACAAAGCATGGAATGTCAATAAGCTAGCCAGGATAGCTCGGAAACAAGGGCTTTATGATGTTTGTGTTCAGATTCT
TGAAAAAATGTATGGACACTCAACAATGGAAGTACAGGAAGCTTTTGTTAAAATTAGAGAGCAAGCAAAAGCTTATCTGG
AAATGAAGGGAGAGCGTGCTAGTGGTCTTAATCTGATCAATAGCACAAATTTGGAGTATTTTCCAGATAAGATCAAAGCA
GAAATATTTCGTCTGAAAGGGGATTTTCATTTGAAACTAAATGACACAGAAAGTGCTAATATTGCATATTCCAATGCGAT
CACTCTGTTCAAGAATTTACCCAAAGGATGGATAAGCTGGGGAAGCTATTGTGACATGGCATATCAAGAAACACAAGAAG
AAATTTGGCTTGAATATGCTGTCAGTTGCTTTCTTCAGGGTATAAGATTTGGAGTTTCCAATTCCAGAAGTCATATAGCT
CGTGTTCTTTATCTTCTTAGCTTTGATACAGCGAATGAGCCTGTTGGCAGAGTGTTTGATAAACACTTAGACCAAGTTCC
TCACTGGGTGTGGCTTTCTTGGATCCCACAGTTGTTACTTTCCCTACAAAGAACAGAAGCACCCCACTGCAAATTGGTCT
TACTGAAAATTGCTGCAGTTTTCCCACAGGCTCTCTATTACTGGTTGCGCACGTACTTGCTGGAAAGACGTGATGCAGTA
AATAAATCCGAACTTGGCAGATTGGTAAGAATGCAGCAAAATGCCTCTGGTGCTAGTGCAGGTCAAGGTGGAAGCAATTT
ACCAGCGGAAACTCAAATCCATCAAGGCGCTCAAATTAGTGGGGCCAGTGGAACACATGACAGTGGTAACGCACATGGGC
AAGAAAGTGATCGCTCCACTGGGGAGAATAATGTCCATCCTGGGAGTGATCAACCTATGCACCAAAGCAGCTCCGCTATC
AATGATAATAATGAAAACACAGTGAGGCGGAATGGTGCATCCTTGACAATCTCTGCTGCGGGTGCTTTTGATGCTGCCAA
AGATATCATGGAAGCTCTTAGGGGTAAACATAACAATTTAGCCAGTGAACTTGAGGTTCTTCTCACAGAAATTGGTTCAA
GATTTGTTACATTACCAGAAGAAAGACTGCTGGCAGTTGTGAATGCTCTGTTGCATCGTTGTTACAAGTATCCAACTGCT
ACCACTGCCGAGGTTCCCCAACCACTAAAAAAAGAGCTGTCGGGTGTCTGCAGAGCTTGTTTCTCGGCAGATGCTGTAAC
CAAGCATGTCGAATTTGTGAAAGAGTACAAGCAGGATTTTGAGCGTCACCTTGATCCAGAAAGTACAGCTACATTCCCGG
TCACACTCGCTGAGCTGACGGCGCGACTAAAAAAGTGGAAAAATATTCTTCAGAGCAATGTTGAAGATAGATTTCCGGCT
GTGTTAAGATTGGAAGATGAGAGCAGGGTTCTGCGTGACTTCAATGTTGTTGATGTGGAGATACCAGGGCAGTACTTTGC
TGATCAGGAAGTAGCACCTGATCATACTATAAAGTTGGATAGGGTTGGAGCAGACGTCCCTATTGTTCGAAGGCATGGAA
GCAGCTTCAGGCGATTGACTCTTATTGGCTCAGATGGCTCGCAAAAGCACTTTATAGTCCAGACATCATTGACTCCTAAT
GCTAGAAGTGATGAACGCATCTTGCAGCTTTTCCGTGTAATGAATCAGATGTTTGATAAGCACAAGGAATCAAGACGACG
ACACATTGGAATTCACACTCCAATCATCATTCCTGTCTGGTCTCAGGTCCGGATGGTTGAGGATGATCTCATGTACAACA
CTTTCCTTGAGGTATATGAAAATCACTGTGCACGAAATGACCGAGAGGCAGATCTTCCAATTACCCACTTTAAGGAGCAA
CTTAATCAAGCAATATCAGGGCAAATCTCAGCAGAGGCAATAGGAGATCTTCGTCTGCAGGCTTACGTAGACATCACAAA
AACCTTGGTCAATGACAGTATCTTCTCTCAGTACATGTACAAGACTTTGATGAGCGGAAGCCATATGTGGGCTTTCAAAA
AACAATTTGCAGTCCAGTTAGCTGTCTCCAGTTTCATGTCCTTCATGCTACAAATCGGTGGGAGGTCCCCGAACAAGGTC
TTGTTTGCAAAAAACACTGGGAAAATGTTCCAGACAGATTTTCACCCTGCTTATGACGCCAACGGGATGATAGAATTTAA
TGAACCGGTGCCTTTCCGCCTTACAAGGAACATGCAAGCATTCTTCTCTCAGTTTGGAGTCGAAGGTCTCCTCATGTCAT
CCATGTGTTCCGCAGCTCAAGCAGTAATCTCCTCCAAGCAAAACGAACATCTACGGTATCAACTTGCTATGTTCTTCCGT
GATGAATTACTGTCTTGGTTTGGAAGAAGACCTCTTGGTGTGCCGATTCCTCCTGTTGGAGGAATTGCTACATTGAACTC
AGTTGATCTGAAGCACAAAGTTAACGCCAATGTGGAAGATGTCATTGGGCGGATCAGAGGAATAGCCCCACAGTATTTTT
CCGAAGAGGACGAGAACACGGTGGAGCCGCCACAGTCAGTGCAAAGAGGAGTGAACGAGTTGGTGGAGGCAGCCTTATCA
CCTCGCAACTTATGCATGATGGACCCAACATGGCACCCTTGGTTCTAG