Details for Capsella Locus Carubv10012558m

Position : scaf_1 ( 5`- 19155232 .. 19160001 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012558m

Protein [Map View]
MENHESDEPMQKKPHLLDSVSPTSMARNSSPSHPIAKSVDATALQFQNQKLVQQLDLQKKQLYDVETKIQELQINQTSYD
DELLSVNRLWNQLVDDLILLGVRAGANQEALNYLDTVDKKRVPPCPADETFLCRLLQVDSLDTRNSDEVLRKVEEALALR
HSSTMELMGLFENTITTQRSKAESISQNLHAAKSAEDAALQLSNINDLLKEEATNLREMIDALHVRHKEHTEQIQAYISS
HSTDQSELKHLKGQLEEIKAELEENRRKLINKIQKDAACEGHVTPPAIANGSLSPEKPVDKKKLRELKDSIDEIKIMAEG
RLSELQAAQEYNLSLSRQCQDIENELKDDQYIYSSRLYSLINDQLYHWNAELDRYKILTEASQAERSFVMRRDKELNLRA
ESLEAASHKTTIVGSRIEVLEQKLQSCIVEKNGLELETEEAIQDSERQDIKSEFIAMASTLSKEMEMMEAQLKRWKDTAH
DALYLREQAQSLRVSLSNKADEQKGIEDKCAEQMAEIKSLKALIEKLLKEKLELQNLASICTRECNDERGLAEIKESQRK
AQAQAEELKNVLDEHFLELRVKAAHETEIACQERLATAKAEIAELRTQLDLSEREVLELKEGIKVKEQEAEASIAEMETI
GQAYEDMQTQNQNLLQQVAERDDYNIKLVSESVKTKNAYNTHLSEKQVMEKQLLQVNASVEALKARIAHSEEQMKSCFSE
AYKLIQEDRHLALSLETTKWEVADADKEFRWLKSAVSSSEKEYEQICRRTKDIILELDDDRREKKKLEEELMELNKELEE
LGSESVEAAIVRLQEEVKNCKNILKCGVCFDRPKEVVIVKCYHLFCQQCIQRSLEIRHRKCPGCGTAFGQSDVRLVKM*

DNA
ATGGAGAATCATGAATCAGACGAACCGATGCAGAAGAAGCCTCATCTTCTAGACTCCGTTTCTCCGACTTCCATGGCCCG
TAATTCTTCACCTTCTCATCCCATCGCTAAAAGTGTTGATGCAACCGCTCTACAGTTTCAGAATCAGAAACTTGTCCAGC
AATTAGACCTGCAGAAGAAACAGCTATACGATGTTGAAACGAAGATCCAAGAGTTGCAAATCAACCAAACATCTTATGAT
GATGAACTTCTCTCAGTTAACCGGCTTTGGAATCAGTTGGTAGATGATCTGATATTGCTTGGAGTTCGTGCCGGGGCTAA
TCAAGAGGCTCTAAACTACTTGGACACTGTAGATAAAAAGCGAGTTCCGCCATGCCCTGCTGATGAAACGTTTCTGTGTA
GACTTCTGCAAGTAGATTCCTTAGATACCAGAAATAGTGATGAGGTATTAAGAAAGGTTGAAGAAGCTCTTGCTTTGCGT
CACTCCTCTACAATGGAGTTGATGGGACTCTTTGAAAACACCATTACTACACAGAGGTCGAAAGCTGAAAGCATATCACA
AAATTTACATGCTGCAAAATCGGCAGAAGATGCCGCCCTCCAGTTGTCTAACATTAATGATTTGTTGAAAGAGGAGGCCA
CAAACTTGCGTGAGATGATTGATGCTTTACATGTGAGGCACAAAGAACATACTGAGCAGATTCAGGCATACATAAGCAGC
CATTCAACAGATCAGTCCGAGCTTAAACACCTGAAAGGTCAATTGGAAGAGATCAAGGCTGAGCTTGAAGAAAATAGAAG
AAAATTGATAAATAAAATCCAGAAGGATGCTGCATGTGAAGGTCATGTAACACCACCAGCAATAGCTAATGGAAGCCTTT
CTCCTGAGAAGCCTGTTGACAAGAAAAAGTTGCGTGAATTGAAGGACTCAATTGATGAGATAAAAATAATGGCAGAAGGT
CGTCTGTCTGAACTTCAAGCCGCACAAGAGTATAATCTTTCCCTGTCAAGACAATGTCAAGATATTGAGAATGAGCTAAA
GGATGACCAGTATATATACTCTTCTAGACTGTATAGTTTGATCAATGATCAACTTTATCACTGGAATGCTGAACTGGACC
GATACAAAATTCTGACTGAGGCCAGTCAGGCTGAAAGGTCCTTCGTAATGAGACGGGATAAGGAACTAAATCTAAGGGCA
GAATCCCTGGAAGCAGCTAGCCATAAGACTACCATTGTTGGTTCTAGAATTGAGGTGCTGGAACAGAAGCTGCAGAGTTG
TATAGTTGAAAAGAATGGATTAGAGCTTGAAACGGAAGAAGCTATTCAGGATTCTGAGCGGCAAGATATTAAAAGTGAGT
TTATTGCAATGGCATCAACCTTATCTAAGGAGATGGAAATGATGGAAGCACAGCTGAAACGGTGGAAAGACACTGCACAT
GATGCTCTTTACCTGCGTGAACAAGCTCAGTCGCTGAGAGTTTCGTTAAGTAACAAGGCAGACGAACAGAAGGGTATAGA
GGATAAATGTGCCGAACAGATGGCGGAAATTAAGTCTCTCAAGGCTCTAATTGAGAAACTTCTGAAAGAGAAATTAGAGC
TGCAAAATCTAGCAAGCATTTGTACTCGTGAGTGTAATGATGAAAGAGGATTGGCAGAAATCAAGGAATCACAACGGAAA
GCCCAAGCGCAGGCTGAAGAGCTGAAAAACGTTTTAGATGAACACTTTCTTGAATTGAGAGTGAAAGCTGCTCATGAGAC
TGAAATTGCTTGCCAAGAAAGGCTTGCTACCGCGAAGGCTGAAATTGCTGAATTGAGGACTCAGTTAGATCTTTCTGAGA
GGGAGGTTTTGGAACTTAAGGAGGGTATTAAAGTTAAAGAGCAGGAGGCAGAGGCATCCATTGCTGAAATGGAGACTATT
GGTCAAGCCTATGAAGACATGCAGACACAGAACCAAAATTTGTTGCAGCAGGTGGCTGAGCGGGATGATTATAATATCAA
GCTTGTTTCCGAGAGCGTCAAGACAAAGAATGCTTATAACACTCACTTATCTGAGAAGCAAGTAATGGAAAAGCAGCTCC
TACAAGTTAATGCGTCAGTTGAGGCTCTAAAAGCAAGGATTGCACATAGTGAGGAACAGATGAAAAGCTGTTTTTCTGAG
GCTTATAAATTGATTCAAGAAGATCGTCACCTCGCTCTCAGCCTCGAAACCACCAAGTGGGAAGTAGCTGATGCTGACAA
GGAATTCAGGTGGCTGAAGTCGGCTGTTTCTTCATCCGAGAAGGAATATGAACAGATATGTAGGAGGACAAAAGACATCA
TATTGGAACTGGATGATGACAGGAGGGAGAAGAAGAAGCTTGAGGAAGAGTTGATGGAGTTGAACAAGGAGCTTGAAGAG
TTGGGTTCTGAGAGTGTAGAAGCTGCAATAGTGAGACTCCAGGAAGAAGTTAAGAATTGCAAAAACATCCTCAAATGTGG
CGTTTGTTTTGATCGGCCTAAAGAGGTGGTAATTGTGAAATGTTATCATCTCTTCTGCCAGCAATGCATCCAACGTAGCT
TAGAGATCCGACACCGGAAATGTCCAGGCTGCGGTACCGCCTTTGGCCAGAGTGACGTCCGGCTTGTCAAAATGTAA