Details for Capsella Locus Carubv10012222m

Position : scaf_1 ( 5`- 19184237 .. 19194030 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012222m

Protein [Map View]
MWTNVFRIGGLHNVSWFQFLPSETELNPGSDRSSRAEQNDVATYLVLSSHLRLQKEGFLTTWTNSFVGPWDPSQGLYNPD
EKIKLWLFLPGRHSSITDKAQAAVPKLRVVASGIWVAPGDSEEISVALSQSLRNCIERSLTGLSYMRFGDVFSKFSPQSE
EYLRRGQPTVEFIFAATEEAVFVHVIISAKNVRTLSSGDAERLLKSSLKNSSYRLPVIVSPHGMRGSLTGFCPNDLVKQV
YFSSGNLRTSSGYIGLSSHVGHGSSLINGNHSYVEVTLGCCQSRNENTSQINSTFAVNLPHNQCPEPSVGSKDHRKGEQD
LLSVCEKKFIYPAEAVLVPILQSSFAKFSLKRFWLQNWIGPSLAGSSLFMHWAGDFDSLGASGNKSDGFYEKGGYNSSGS
SRNSSISSTSSASSGSGWRMTRTGDLDADADSLTCRQSGLTCNDDRPKMGSKRPRTGMGESFGQVGIENDQIGWDWDDDD
DDDDDREVGMDIKALLSEFGDFGDFFENDALPFGEPPGTAESHALMFPPDSVDVGSSPVDMMDVSDQIVLPVGFSSFESF
NPVPPIIDECLIKSQDVLNSSITSVPPNQMPVSSTGEFDHLMKAEAMMTFAPEYGAVEAPMSEISPTFFKSPYLPKSHKV
ESSNSRTSNYVYGATPPATDSDGAADKILYGSKAGIGKNDCRTLFQLKKHYIQVEGRKGQLPTVISDNNSTKEGVSQSKH
SKHSAANAVKIVQGKKTNGISAVVSTLLYSKTLLATDVGSVMFQAFMCRMRHIAASSKHNSPASLTRLSGNFFLNQLPNE
PSTLTDNISARNEIYKKDIPTRIAGDFDGGMIDGHMSAPVGVWRTVSVPKTAKPASSPNIEAGSSLPHSSFSEDSLLSYG
QRQPLQELLDGIALLVQQATSFVDLALDSDCGDGPYGWLALEELWRRELSCGPSAVHAGCGGTLASCHSLDIAGVKLVDP
LSAEVFPSSVITLLQSDIKTALKSAFGQSDGPLSVTDWCKGRNQSGDGGSISEGSTAESALTEVSIDGAKGDETTQSQDI
YSSELLRPTLFVLPSPSILVGYQDDWLKISTNSLPHWEKAPFEPYALPKNINYTVVCPDIDPLTCAAADFFQQLGTVYEM
CRLGTHLPQSLGNQMETDAGKLSSSGFVLLDYPQSMKIESNNTSLLGSLSDYFLSLSNGWNVSSYLKSLSKALKGIKLGS
YLYTNQKEGSGSPCMVVYIVCPFPDPSAVLRTIVESSIALGSVIQSDRDRRSILNSQVARAFGSSAAVDETSISHIPVLS
GFNVPKLVLQVVSVDSIFRITSPSFNELVILKDTAFSVYNKARRISRGVPNDAFLSSSLSGRSTSALTPMSSISGIWKDC
VGSRMTGSTHPRDGEMDVSLRTGGWDTSWQIPRSGGLSCDPNRNGDFYLNDEIFYLFEPLFILSEPGSVERGVSPSFGGL
GSESSKPIPEDGGRGSGAGLNSMEGITSGSNSQGDASQLEGKAIPSLHCSYGWTEDWRWLVSIWTDARGELLDTHIFPFG
GISSRQDTKGLQCLFVQVLQQGCQILQACSSPDNGSYKPRNFVITRIGNFFELEYQEWQKAIYSAGGPEIKKWPIQLRRS
APSGIASNSNGSSLQQQDLSLIQERASSTSTLYSSHSKPSTFVKGSMGQSAGRKQIMGGQTISGTPRGLFQWVHSISFAS
ISLDHSLHFVLPAELVSAGGGQSSTGMSSVNYIEGFTPVKSIGSTAFSYMMIPSPNMRFLHPSPLQLPTCLTAESPPLAH
LLHSKGCAIPLSTGFVVSKAVPSMRKDSRINIKEEWPSVLSVSLVDYYGGYGHAHDKILQGSMKQGGGTKETRDFEVESH
IILESIAAELHALSWMTVSPVYLDRRTALPFHCDMVLRLRRLLHFADKELSRLPDKSGDHLTAIYCLHRNFLSSCYRFLS

DNA
ATGTGGACTAATGTTTTTAGAATTGGTGGTCTACATAATGTTTCGTGGTTTCAGTTTCTTCCAAGTGAAACTGAGCTGAA
TCCTGGTTCTGATAGAAGTTCAAGAGCTGAGCAAAACGATGTTGCAACGTATCTTGTCCTTTCTTCTCATCTCCGGTTGC
AGAAGGAAGGGTTTCTTACTACTTGGACTAATTCTTTTGTTGGACCTTGGGATCCATCTCAAGGTTTATACAACCCTGAT
GAAAAGATTAAGCTTTGGCTTTTTCTACCTGGGCGTCATTCGTCAATAACTGATAAAGCTCAGGCTGCTGTGCCAAAGCT
TAGAGTTGTTGCGTCAGGAATTTGGGTAGCACCTGGGGACTCTGAAGAGATATCAGTTGCCTTATCACAGTCTTTACGTA
ATTGCATTGAAAGATCACTAACTGGACTTTCCTACATGAGATTTGGAGATGTGTTTTCAAAATTCAGCCCTCAAAGCGAA
GAATATTTGAGGAGGGGACAGCCTACTGTCGAATTCATCTTTGCTGCCACTGAAGAGGCAGTTTTTGTCCATGTCATTAT
ATCTGCCAAGAATGTCCGGACACTTTCAAGTGGCGATGCTGAAAGACTGTTAAAGAGTTCTTTGAAAAACTCCAGCTATA
GGCTTCCAGTGATTGTTTCTCCTCATGGAATGCGGGGTAGCCTCACTGGATTCTGTCCCAACGACCTTGTCAAGCAAGTC
TACTTCAGTTCTGGAAACTTAAGGACTTCGAGTGGATATATTGGTCTCTCTTCTCATGTTGGTCATGGGTCCAGTCTGAT
AAATGGCAATCATTCCTACGTGGAAGTTACACTTGGTTGCTGCCAAAGTAGAAATGAAAACACAAGTCAAATTAATTCGA
CCTTTGCAGTTAACTTACCCCATAATCAGTGTCCTGAACCTTCCGTTGGCAGTAAAGATCACCGGAAAGGAGAACAAGAT
CTTTTATCAGTGTGTGAAAAAAAGTTCATATATCCAGCTGAGGCAGTGCTGGTGCCAATCTTGCAGTCATCATTTGCTAA
ATTTTCTTTGAAAAGATTTTGGCTTCAAAATTGGATAGGCCCGTCACTGGCAGGCTCATCGTTATTTATGCACTGGGCTG
GTGATTTTGACTCCCTTGGAGCATCTGGAAATAAGAGTGATGGCTTTTATGAAAAAGGTGGTTACAATAGCAGTGGTAGT
AGCCGTAATAGCAGCATTAGTTCAACAAGTAGCGCTTCTAGTGGGAGTGGCTGGAGAATGACTAGAACTGGTGACCTTGA
CGCTGATGCAGATTCTTTGACGTGTAGGCAATCTGGTCTTACTTGTAATGATGATCGCCCAAAAATGGGTTCCAAGCGGC
CGCGAACAGGGATGGGAGAGTCTTTCGGTCAAGTAGGCATTGAAAATGATCAAATTGGTTGGGATTGGGATGATGACGAT
GATGATGATGACGACAGAGAAGTTGGCATGGATATCAAGGCACTTCTTTCAGAGTTTGGAGACTTTGGTGACTTCTTTGA
GAACGATGCTTTGCCTTTCGGGGAGCCACCTGGAACTGCAGAGTCGCATGCGCTCATGTTTCCTCCAGATTCTGTTGATG
TAGGTTCCAGTCCAGTTGATATGATGGATGTATCAGACCAAATCGTACTGCCTGTCGGGTTTTCCTCGTTTGAGAGCTTT
AATCCTGTTCCTCCTATCATAGATGAGTGCCTTATTAAAAGTCAAGATGTTCTCAACAGCAGTATCACTTCAGTTCCTCC
AAATCAAATGCCAGTCTCTTCTACTGGTGAGTTCGATCATTTGATGAAAGCTGAAGCTATGATGACCTTTGCTCCTGAGT
ATGGAGCTGTAGAAGCACCTATGAGCGAGATTTCCCCCACGTTTTTCAAAAGCCCATATCTTCCCAAATCTCATAAAGTG
GAGAGTTCGAATTCAAGAACGAGTAATTATGTTTATGGAGCTACACCACCTGCCACTGATTCTGATGGAGCAGCCGATAA
GATTTTGTACGGATCCAAAGCAGGCATTGGTAAAAATGATTGCAGAACTTTGTTTCAGTTGAAGAAGCACTACATTCAAG
TGGAGGGTAGAAAGGGCCAACTACCTACTGTTATCAGTGACAACAATAGTACAAAGGAGGGTGTTTCTCAATCAAAACAC
TCAAAACATAGTGCTGCTAATGCTGTTAAGATTGTGCAGGGGAAAAAGACTAATGGTATATCTGCTGTTGTTAGTACATT
ATTATATTCAAAGACCTTGCTAGCAACAGACGTGGGAAGTGTTATGTTCCAAGCTTTCATGTGTAGGATGCGGCACATAG
CCGCTTCTTCAAAGCACAATTCACCTGCTAGTTTAACTAGGCTTAGTGGAAATTTTTTTCTTAACCAGCTGCCAAATGAG
CCTAGTACTCTGACAGACAACATATCTGCAAGGAATGAGATATATAAGAAAGATATACCTACCAGAATAGCTGGAGATTT
TGACGGAGGAATGATAGATGGCCACATGAGTGCACCAGTTGGCGTATGGCGGACTGTTTCAGTCCCAAAAACAGCAAAAC
CTGCTAGTTCGCCAAATATTGAAGCAGGGTCATCCTTGCCCCATAGTTCATTTAGCGAAGACAGCTTGCTTTCTTATGGT
CAAAGGCAGCCACTGCAGGAGCTCTTAGATGGGATAGCGTTACTTGTTCAGCAAGCTACCTCTTTTGTTGATTTAGCTCT
GGATTCAGATTGTGGAGATGGACCCTACGGCTGGCTTGCATTGGAAGAATTGTGGAGGCGGGAACTGTCATGTGGACCCT
CTGCTGTCCATGCAGGTTGTGGGGGGACTTTGGCTTCCTGCCATTCTCTGGACATTGCTGGTGTCAAATTAGTTGATCCA
CTATCTGCTGAGGTTTTTCCTTCGTCTGTCATCACTTTACTTCAGTCTGACATCAAAACAGCTCTGAAATCTGCATTTGG
TCAGTCAGATGGCCCATTATCTGTTACAGATTGGTGCAAGGGCCGAAATCAATCAGGGGATGGAGGATCTATTTCTGAGG
GATCTACTGCTGAGTCAGCCCTGACTGAAGTGTCTATAGATGGCGCCAAAGGGGATGAGACGACTCAGAGCCAAGACATA
TACAGTTCAGAATTACTCCGACCAACACTTTTTGTTCTTCCATCACCTTCTATACTTGTTGGGTACCAAGATGACTGGCT
TAAGATATCAACAAATTCCTTGCCACATTGGGAAAAGGCCCCTTTTGAGCCATATGCTCTGCCAAAAAATATTAACTACA
CTGTTGTATGCCCGGATATTGATCCTCTAACCTGTGCTGCTGCTGATTTCTTCCAGCAACTTGGAACTGTTTATGAGATG
TGTAGACTGGGAACCCATTTGCCACAAAGCCTGGGAAATCAAATGGAAACAGACGCTGGAAAATTGTCTTCATCTGGATT
TGTTCTACTTGATTACCCCCAATCAATGAAGATTGAAAGCAATAACACATCGCTTCTGGGATCTCTCAGCGATTATTTTC
TGTCTTTGTCGAACGGGTGGAATGTGAGTAGCTATCTGAAGTCTTTATCAAAGGCGTTGAAAGGTATAAAGCTTGGGTCT
TACCTTTACACAAACCAGAAAGAAGGATCAGGGAGTCCTTGTATGGTAGTATACATAGTGTGTCCATTTCCTGACCCTTC
AGCAGTTTTAAGGACGATCGTCGAATCGTCTATAGCACTTGGGTCAGTAATACAGTCAGATAGAGACAGGAGATCGATAC
TTAACAGTCAGGTTGCAAGGGCTTTTGGTAGTTCTGCTGCTGTTGACGAAACATCAATATCTCACATTCCAGTGCTTTCA
GGGTTTAATGTCCCTAAGTTAGTTCTACAAGTGGTGTCTGTTGATTCTATTTTCCGTATTACAAGTCCAAGCTTTAATGA
GCTTGTCATTCTCAAGGATACTGCTTTTTCTGTATATAATAAAGCTCGGAGAATTTCAAGAGGAGTACCGAATGATGCAT
TCCTGTCATCATCTTTATCTGGCAGATCCACTTCAGCGTTGACACCAATGAGCTCTATTTCAGGAATCTGGAAAGACTGT
GTTGGTTCTCGAATGACAGGTTCTACACATCCAAGAGATGGCGAAATGGATGTTAGCTTGAGAACGGGTGGTTGGGATAC
TTCCTGGCAAATACCGAGATCTGGAGGTTTAAGCTGTGACCCAAACAGAAATGGAGATTTTTACCTAAATGATGAAATTT
TCTATTTATTTGAACCACTTTTCATTCTTTCTGAGCCTGGTTCTGTGGAGCGTGGAGTTTCACCTTCTTTTGGCGGCTTG
GGATCTGAGTCTTCAAAGCCAATACCTGAGGATGGTGGCAGAGGTTCTGGAGCTGGTTTGAATTCAATGGAAGGTATAAC
ATCGGGATCTAACTCCCAGGGTGATGCATCCCAGCTTGAAGGAAAGGCTATTCCAAGTTTACATTGCTCCTACGGTTGGA
CAGAGGACTGGAGGTGGCTTGTAAGCATCTGGACGGATGCCAGGGGTGAATTACTTGACACACATATATTTCCCTTTGGT
GGAATTAGCAGCAGACAGGATACGAAAGGGCTGCAGTGTCTTTTTGTTCAAGTTCTGCAGCAGGGATGTCAAATACTACA
GGCGTGTTCCTCCCCTGATAATGGATCTTACAAACCCAGGAATTTTGTCATTACACGCATTGGGAATTTCTTCGAGCTTG
AATACCAAGAGTGGCAAAAGGCAATTTACTCAGCTGGAGGTCCTGAGATTAAAAAGTGGCCTATTCAACTTCGACGTTCT
GCGCCTTCTGGAATAGCCTCCAATAGCAACGGATCTTCCTTGCAACAGCAGGATCTGAGTTTGATTCAAGAGAGAGCCTC
ATCAACTAGCACACTCTACAGCTCTCATTCAAAACCATCCACCTTTGTGAAAGGCAGTATGGGGCAATCTGCTGGAAGAA
AGCAGATCATGGGTGGGCAAACCATTTCTGGTACTCCAAGGGGATTGTTTCAGTGGGTTCATAGCATCAGTTTTGCTTCT
ATTTCACTCGATCATTCTCTGCATTTTGTTCTTCCAGCTGAGTTGGTTTCTGCTGGAGGTGGCCAGAGTAGTACTGGTAT
GAGTTCAGTTAATTACATTGAAGGTTTCACTCCTGTCAAATCTATCGGGTCTACTGCTTTCTCTTACATGATGATACCAT
CACCCAATATGCGCTTTCTTCACCCAAGTCCTCTTCAGCTTCCTACATGTTTAACTGCCGAGTCACCTCCACTTGCACAC
CTCCTTCACAGCAAAGGATGTGCAATCCCTCTGTCTACCGGATTTGTTGTTTCAAAAGCTGTGCCTTCCATGAGAAAAGA
CTCAAGAATAAACATTAAAGAAGAATGGCCATCAGTTCTTTCTGTAAGTCTTGTAGACTATTATGGTGGTTATGGCCATG
CTCACGACAAAATTCTTCAAGGAAGCATGAAGCAAGGAGGAGGGACCAAAGAAACTAGAGACTTTGAAGTTGAAAGCCAT
ATTATCCTTGAGTCAATAGCGGCAGAACTCCATGCTCTATCATGGATGACTGTTAGTCCAGTATATCTGGACAGGCGTAC
GGCATTGCCGTTTCACTGTGATATGGTTTTGAGATTGAGACGTCTGCTTCATTTTGCGGACAAAGAACTCTCCAGGCTAC
CGGATAAGTCGGGAGACCATCTTACTGCTATCTATTGTTTGCATAGAAACTTCCTCAGCAGTTGCTACCGTTTCTTATCT