Details for Capsella Locus Carubv10012089m

Position : scaf_1 ( 5`- 19180201 .. 19183477 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012089m

Protein [Map View]
MWKSIRELSCDDYVKAGLTLEDAKEFEKLVSDVISKTKKTDPRDQWKALMDENVLKPWHPHPLHQLLYYSVYSNWDSSVH
GPPLYWFPSPSQSKSTNLGKLMETHGSRLLGASYKNPLESFELFRRFSVEHPQVYWSLVIDELSLVFRSPPRCILDKSKL
GGTWLPDAVLNIAECCLMPSSHPKKDDDSVAVVWRDEGFDDSPVNQMTLKELRERVTLAAKAIGGSFEKGDTIAIDMPMT
VDAVIIYLAIILAGCVVVSIADSFAAKEIATRLKISKAKGIFTQDYILRGGRRFPLYSKVVEAAPSKVIVLPSSGTELCV
QLREQDIPWMDFLSNWKTLLSGDNYYRPIYLPVDAVINILFSSGTTGEPKAIPWTQLSPIRSACDGWAHADVQVGNIYCW
PTNLGWVMGPTLIFSCFLTGATLALYNGSPLGWGFGKFVQDAGVTVLGTVPSLVKTWKRINCMEGLNWTKIKYFATTGEA
SNVDDVLWLSSKAYYKPVIECCGGTELASSYIIGSPLQPQAFGAFSTPSMTTRIIIFDENGVPYPDDQPCTGEVGLFPQH
LGATDRLLNADHDEVYFKGMPMYKETRLRRHGDILRRTVGGYYNVQGRADDTMNLGGIKTSSIEIERVCDQADECISETA
AVSLAPPDGGPELLVIFTVLKEGFKKQSEEELKMKFSRTIQRDLNPLFKVSLVKIVPEFPRTASNKLLRRVLRDQMKKEL
LSLRSRI*

DNA
ATGTGGAAGAGCATACGTGAATTGAGTTGCGATGATTATGTCAAAGCTGGATTGACTTTGGAAGACGCCAAAGAATTTGA
AAAATTGGTGAGTGATGTGATTTCAAAGACTAAAAAGACTGATCCAAGAGATCAGTGGAAGGCTTTGATGGATGAGAATG
TGCTTAAGCCATGGCATCCGCATCCTCTGCATCAGCTTCTCTATTACTCTGTCTATTCTAACTGGGACTCCTCTGTTCAT
GGCCCCCCTCTCTATTGGTTTCCTTCTCCATCTCAGTCAAAATCCACAAATTTGGGGAAGCTGATGGAAACTCACGGGTC
AAGGCTTCTTGGTGCTTCATATAAAAACCCTCTTGAAAGTTTTGAACTTTTCCGGAGATTCTCAGTTGAACACCCTCAAG
TTTATTGGTCACTCGTTATCGATGAGCTTTCACTCGTGTTTCGTTCTCCTCCTAGGTGCATCCTTGACAAATCAAAACTT
GGAGGGACATGGCTTCCTGATGCAGTTCTGAATATTGCTGAATGTTGTCTGATGCCTTCAAGCCATCCCAAAAAGGATGA
TGACAGTGTGGCGGTTGTATGGCGAGATGAAGGCTTTGATGATTCTCCAGTCAATCAAATGACATTGAAAGAACTCCGCG
AGCGAGTAACGTTGGCGGCAAAGGCGATAGGTGGAAGTTTTGAAAAGGGTGACACTATTGCAATCGATATGCCAATGACA
GTTGATGCAGTGATTATATATCTCGCAATCATATTAGCCGGTTGCGTTGTTGTCTCCATCGCAGACAGCTTTGCAGCTAA
AGAAATTGCAACACGGTTGAAAATTTCTAAGGCAAAAGGCATATTCACTCAGGACTATATACTCAGAGGAGGTCGAAGAT
TTCCTTTATACAGCAAGGTGGTTGAAGCTGCTCCATCTAAGGTCATTGTCCTCCCCTCTTCAGGGACTGAATTGTGTGTT
CAGTTAAGAGAACAGGACATACCATGGATGGATTTCCTTTCCAACTGGAAAACACTTCTTAGTGGAGATAACTACTATCG
TCCAATTTATCTACCTGTAGACGCTGTGATTAACATTCTCTTCTCATCTGGAACGACAGGTGAACCGAAAGCTATACCGT
GGACACAGCTCTCGCCAATTCGTAGTGCTTGTGATGGATGGGCTCATGCTGATGTCCAAGTGGGTAATATATATTGTTGG
CCTACAAATCTTGGATGGGTAATGGGACCAACTCTTATATTTTCCTGCTTTCTAACTGGTGCAACTCTGGCTCTCTACAA
CGGGTCTCCCCTTGGCTGGGGTTTTGGAAAGTTTGTTCAGGATGCTGGAGTTACAGTTCTCGGTACTGTTCCAAGCTTGG
TGAAAACTTGGAAGAGGATCAACTGTATGGAAGGGCTTAACTGGACAAAGATAAAATATTTCGCCACCACAGGAGAAGCT
TCCAATGTTGATGATGTTCTCTGGCTTTCTTCTAAAGCTTATTACAAACCTGTGATTGAATGCTGTGGAGGCACGGAACT
GGCTTCTTCATACATCATAGGAAGTCCGCTTCAGCCGCAAGCTTTTGGAGCATTTAGTACACCGTCTATGACAACTAGAA
TTATCATCTTCGACGAAAATGGTGTCCCATATCCGGATGATCAACCGTGTACTGGAGAAGTTGGTTTGTTCCCGCAGCAC
CTCGGGGCCACAGATAGACTTCTGAATGCAGACCATGACGAGGTTTATTTCAAGGGAATGCCAATGTACAAAGAAACACG
ACTTAGAAGACACGGTGACATCCTGAGGCGAACGGTAGGAGGATATTACAATGTTCAAGGCAGAGCTGATGATACCATGA
ACCTTGGAGGCATTAAGACGAGTTCTATTGAGATTGAGCGGGTGTGTGATCAAGCTGATGAGTGCATCTCTGAGACGGCT
GCAGTCAGTTTAGCCCCGCCAGACGGTGGTCCAGAGTTGCTGGTCATATTCACCGTCTTGAAAGAAGGGTTCAAGAAACA
GAGTGAAGAAGAGCTAAAGATGAAATTTTCGAGAACCATTCAAAGAGATCTTAATCCTCTCTTCAAGGTAAGTTTGGTGA
AGATTGTACCTGAGTTTCCAAGAACAGCTTCAAACAAGTTATTGAGAAGAGTCTTGAGAGATCAGATGAAGAAGGAACTA
CTATCCTTACGTAGTCGAATATGA