Details for Capsella Locus Carubv10012018m

Position : scaf_1 ( 5`- 19101439 .. 19104680 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10012018m

Protein [Map View]
MRLLKVATCNLNQWAMDFECNMKNIKASITEAKAAGAVIRLGPELEVTGYGCEDHFLELDTITHAWECLKELLLGDWTDG
ILCSIGMPVIKGAERYNCQVLCMNRRIIMIRPKMWLANDGNYRELRWFTAWKQREHLDEFQLPIEISEALDQKSVPFGYG
YIQFIDTAVAAEVCEELFSPLPPHAELALNGVEVFMNASGSHHQLRKLDIRLNAFMGATHARGGVYMYSNQQGCDGGRLY
YDGCACIVVNGDVVAQGSQFSLRDVEVIISQVDLDAVASLRGSISSFQEQASCKVKVSSVAVPCRLTQSFNLKMTLSSPK
KIMYHSPQEEIAFGPACWMWDYLRRSGASGFLLPLSGGADSSSVAAIVGCMCQLVVKEIAKGDEQVKADANRIGNYSNGQ
FPTDSKEFAKRIFYTVFMGSENSSEETKRRAKQLADEIGAWHLDVCIDGVVSAVLTLFQTVTGKRPRYKVDGGSNAENLG
LQNIQARMRMVLAFMLASLLPWVHSKPGFYLVLGSSNVDEGLRGYLTKYDCSSADINPIGSISKTDLRLFLKWAATDLGY
PSLAEIEAAPPTAELEPIRSDYSQLDEVDMGMTYEELSVYGRMRKIFRCGPVSMFKNLCYKWGTKLSPAEVAEKVKYFFK
YYSINRHKMTVLTPSYHAESYSPEDNRFDLRQFLYNSRWPYQFKKIDEIVDGLNGDSVAFPEEAGNSEKEVGVVAANSED
PSAGL*

DNA
ATGAGGCTGTTGAAGGTTGCGACGTGTAACTTGAACCAATGGGCCATGGATTTCGAGTGCAACATGAAGAATATCAAGGC
TTCCATCACCGAGGCAAAGGCTGCCGGTGCTGTCATCAGGCTTGGACCTGAGCTGGAAGTCACTGGTTATGGCTGCGAGG
ATCATTTCTTGGAGCTAGACACCATCACTCACGCGTGGGAGTGTTTGAAGGAATTGCTGCTTGGTGATTGGACGGATGGT
ATATTGTGCAGCATTGGAATGCCTGTGATTAAAGGAGCAGAACGGTATAACTGTCAGGTTCTCTGTATGAACAGAAGAAT
CATCATGATTCGACCAAAGATGTGGCTTGCAAATGATGGAAACTATAGGGAGCTTAGGTGGTTCACGGCTTGGAAGCAGA
GAGAACACCTCGATGAATTTCAGCTCCCTATTGAAATCTCTGAGGCTTTGGATCAGAAATCTGTTCCTTTTGGTTATGGT
TACATCCAGTTTATCGACACGGCTGTTGCAGCTGAAGTCTGTGAGGAACTGTTTAGTCCACTTCCTCCTCATGCTGAGCT
TGCATTGAATGGGGTTGAGGTATTTATGAATGCAAGTGGGAGTCATCACCAACTGCGAAAGCTAGATATCCGTTTGAATG
CTTTCATGGGGGCTACTCATGCTCGTGGTGGGGTGTATATGTACAGTAATCAACAGGGATGTGATGGTGGCCGCTTATAT
TACGATGGATGTGCATGCATTGTTGTAAACGGGGATGTTGTTGCTCAAGGCTCACAATTCTCGTTGAGGGACGTTGAGGT
CATCATATCCCAAGTGGATCTTGATGCGGTTGCGAGTCTTCGAGGATCTATAAGTAGTTTCCAGGAACAAGCAAGCTGCA
AGGTTAAAGTATCTTCAGTAGCTGTGCCCTGTAGACTGACACAGTCCTTCAATCTAAAAATGACACTGAGCAGTCCGAAG
AAGATCATGTACCACTCTCCACAAGAAGAAATAGCCTTTGGTCCCGCCTGCTGGATGTGGGACTATTTGAGAAGAAGTGG
CGCTTCGGGGTTTTTGCTCCCTCTTTCTGGTGGAGCAGACAGCTCCTCCGTGGCAGCCATTGTTGGCTGCATGTGCCAAC
TTGTTGTTAAAGAGATTGCAAAGGGAGATGAGCAAGTAAAAGCTGATGCGAATCGAATTGGGAATTATTCTAATGGACAG
TTTCCTACTGATAGCAAAGAGTTTGCCAAACGCATATTTTACACTGTCTTTATGGGGTCTGAAAACAGTTCTGAGGAGAC
AAAAAGGCGTGCAAAGCAGCTGGCAGATGAGATCGGTGCTTGGCATCTTGATGTGTGCATAGATGGCGTTGTCTCTGCGG
TTCTAACTTTATTTCAAACGGTTACAGGCAAGCGACCTCGGTATAAGGTTGATGGAGGATCAAACGCTGAGAACCTTGGG
TTGCAGAACATTCAAGCCCGGATGAGGATGGTGTTAGCATTTATGTTAGCATCTCTCTTGCCTTGGGTTCATAGCAAACC
AGGATTTTACCTTGTTCTAGGCAGCTCGAATGTTGATGAAGGACTTCGTGGTTACCTGACAAAGTATGATTGCAGCTCAG
CAGACATAAATCCCATAGGAAGTATCAGTAAAACGGATTTGAGGTTGTTCTTAAAATGGGCTGCAACGGATCTCGGATAT
CCATCCCTGGCAGAGATAGAAGCTGCTCCACCAACCGCTGAGCTTGAGCCCATTCGTTCTGACTATTCTCAGCTGGATGA
AGTCGACATGGGAATGACTTATGAAGAGCTTTCAGTGTATGGAAGGATGAGGAAGATATTCCGGTGTGGACCAGTTTCTA
TGTTCAAGAATCTATGTTACAAGTGGGGAACAAAGCTAAGCCCAGCAGAAGTAGCTGAGAAAGTGAAGTATTTCTTCAAA
TACTATTCGATCAATCGACACAAGATGACTGTCCTCACACCGTCCTACCACGCTGAGAGTTACTCTCCAGAGGACAACAG
ATTCGATCTGAGGCAGTTTTTGTACAACAGCAGGTGGCCGTACCAGTTTAAGAAGATTGACGAGATAGTTGACGGCTTAA
ATGGCGACTCAGTTGCTTTCCCGGAAGAAGCAGGAAACTCCGAGAAAGAAGTTGGAGTTGTAGCAGCAAACTCTGAAGAC
CCAAGCGCGGGTCTCTGA