Details for Capsella Locus Carubv10011598m

Position : scaf_1 ( 5`- 19151607 .. 19152170 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10011598m

Protein [Map View]
MAKLIFFFALQILLLAVVASAGDGEDFARTMDRKLLGLHRKEKLTHFKVYWHDILSGPNPTSIMIQPPVTNSSYFGAISM
IDNALTAKVPMNSTVLGQAQGFYAGAAQKELGFLMAMNFAFKTGKYNGSTITILGRNTAMSEVREMPIVGGSGLFRFARG
YVEARTKWINLKNGDATVEYSCYVLHY*

DNA
ATGGCTAAACTCATTTTCTTCTTCGCTCTCCAAATCCTTCTCCTCGCAGTTGTTGCATCTGCCGGAGACGGCGAAGACTT
CGCTAGAACCATGGACCGTAAACTTCTCGGTCTCCATAGAAAAGAGAAGCTAACCCATTTCAAAGTCTATTGGCACGACA
TCTTAAGCGGTCCAAACCCAACTTCCATCATGATCCAGCCACCGGTTACAAACTCTTCCTACTTCGGAGCCATCTCTATG
ATCGACAACGCTTTGACCGCGAAAGTTCCGATGAACTCCACCGTTTTGGGACAGGCTCAAGGGTTCTACGCCGGAGCGGC
ACAAAAGGAGTTGGGATTCCTGATGGCCATGAACTTTGCTTTCAAGACAGGGAAATATAACGGAAGCACGATCACCATCC
TTGGTCGGAACACGGCGATGTCGGAAGTCAGAGAGATGCCGATCGTCGGAGGAAGTGGGCTTTTCCGGTTTGCTAGAGGC
TATGTGGAGGCTAGGACAAAGTGGATTAATCTCAAGAACGGAGATGCTACTGTTGAGTACAGTTGTTACGTGTTGCATTA
TTGA