Details for Capsella Locus Carubv10011111m

Position : scaf_1 ( 5`- 19147222 .. 19147482 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10011111m

Protein [Map View]
MASWTEVLTNAAMFVIIQALAFLIISTSSDVFSSKITMNKQKTSFGFKLSRSISQLRALISDDVSRVDEEVAEEEESFLS
RSHLSY*

DNA
ATGGCTTCGTGGACGGAAGTATTGACAAATGCTGCCATGTTTGTGATAATCCAAGCTCTGGCGTTTCTGATCATCTCCAC
TTCTTCCGACGTATTCTCTTCCAAGATCACGATGAATAAACAGAAGACATCTTTTGGCTTCAAACTCTCTCGTTCTATTT
CCCAGTTACGCGCTTTGATCTCCGATGATGTCTCTCGAGTCGATGAAGAAGTAGCAGAAGAGGAAGAAAGCTTCCTCTCA
CGGTCTCACCTCTCATATTAA