Details for Capsella Locus Carubv10010738m

Position : scaf_1 ( 5`- 19145614 .. 19147006 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10010738m

Protein [Map View]
MASSSKVCRLSSKIHSLTQKLTKTNVHVSSLPSPIKTSSPISASTRFSQSFRLPVELSSCLSMLPLHSAIASARLISSLS
VESKNWGLVPQGISMPL*

DNA
ATGGCGTCTTCTTCAAAAGTATGCAGATTATCATCCAAGATACATTCTTTAACCCAGAAGCTTACCAAGACGAATGTTCA
CGTTTCTTCCTTACCTTCTCCCATTAAAACTTCATCTCCAATTTCAGCATCTACCCGTTTCAGTCAATCTTTTAGACTAC
CAGTGGAGCTAAGTAGCTGTTTATCTATGTTGCCACTACACAGTGCTATAGCATCTGCCAGATTGATATCAAGTTTGTCT
GTTGAATCTAAGAACTGGGGTTTAGTTCCTCAAGGTATTTCTATGCCTTTATGA