Details for Capsella Locus Carubv10010376m

Position : scaf_1 ( 5`- 19126083 .. 19127804 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10010376m

Protein [Map View]
MSEETPKLFTNKPKKKAIIAQLKHVEANFNNPSTVPPSSSAPSPAAAAAASYSMGGAPPPPPPPPKQSFARRYKFVWPVL
LTVNLAIGGYLFIRTKKKDTDPVNEETAAKLGAVAAPVTVEKTVSSAVVAEPVVVKAREPIPEKQQRELFKWMLEEKRKV
NPKNAEEKKRIDEEKAILKQFIGSKTIPTL*

DNA
ATGAGTGAAGAAACTCCTAAGCTTTTCACCAATAAACCCAAGAAGAAGGCCATTATTGCTCAGCTGAAGCACGTTGAAGC
CAATTTCAATAATCCTTCTACTGTTCCTCCATCATCGTCAGCACCTTCTCCGGCTGCTGCTGCCGCTGCTTCCTATTCCA
TGGGTGGTGCTCCTCCTCCTCCTCCCCCTCCTCCCAAGCAATCGTTCGCTCGGAGGTACAAATTTGTATGGCCTGTTCTC
CTTACCGTCAATCTCGCCATCGGAGGTTATCTTTTCATTAGAACTAAGAAAAAGGATACAGATCCTGTAAACGAAGAGAC
AGCTGCTAAATTGGGTGCAGTTGCAGCCCCTGTTACTGTGGAAAAGACTGTGTCTTCCGCGGTGGTTGCAGAGCCCGTGG
TGGTCAAGGCACGTGAGCCAATTCCGGAGAAACAACAACGTGAGCTCTTCAAATGGATGTTGGAGGAGAAAAGGAAAGTA
AATCCTAAAAACGCAGAAGAGAAGAAACGGATTGACGAAGAGAAAGCGATTCTGAAACAGTTCATAGGCTCCAAAACCAT
TCCTACTCTCTGA