Details for Capsella Locus Carubv10010370m

Position : scaf_1 ( 5`- 19162379 .. 19164153 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10010370m

Protein [Map View]
MEHLIRTLIITIVTTSMLLGFGNSDLAQDRDECTNQLIALSTCLPYVGGGAKAPTKDCCAGFNQVITKSEKCVCILVKDK
DDPQLGLKINATLAAHLPTACHITAPNITECISILHLARNSTLAKEFESLGRIEENYNSTSPTQIHKDGTGGGKAESVKS
NGGKKKKKSWLGVVELLIFAHLLLIIISSFI*

DNA
ATGGAGCACTTAATAAGAACCCTAATCATAACCATCGTGACAACCTCCATGTTGCTAGGGTTTGGAAACTCAGATCTGGC
TCAGGACAGAGACGAGTGTACGAACCAACTCATAGCACTCTCCACGTGTCTTCCGTACGTTGGAGGAGGCGCCAAGGCTC
CGACAAAAGATTGCTGTGCAGGGTTTAACCAAGTTATAACAAAGAGTGAGAAGTGTGTTTGCATATTGGTCAAAGACAAA
GATGATCCTCAACTTGGTCTCAAGATTAACGCAACCCTAGCCGCTCATCTTCCCACCGCCTGCCACATAACGGCTCCTAA
CATCACCGAGTGTATTTCAATTCTGCATTTAGCTCGAAACTCAACATTGGCTAAAGAGTTTGAGAGCTTAGGAAGGATTG
AAGAAAACTACAACAGCACATCTCCTACACAAATCCATAAAGATGGGACAGGAGGAGGGAAAGCAGAATCAGTGAAGAGT
AATGGAGGGAAGAAGAAGAAGAAGAGTTGGTTGGGTGTTGTTGAGCTTTTAATATTTGCTCATCTTCTTTTGATTATCAT
CTCTTCTTTTATTTAA