Details for Capsella Locus Carubv10010152m

Position : scaf_1 ( 5`- 19099467 .. 19100702 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10010152m

Protein [Map View]
MQQFQQFQQQQHFIQQQQYQQQQQQQQRLLQSPPLPQPQQSLQSPPPQQTVVHTPQSMMHTPQQQQQLVQTPQQHQSLAS
HFHLYPMVEKLTDAIENGTRDQNSDALVTELNSHFEKCQQLLNSISGSLGSKTMTVDGQKRNVEESEQLLQQRRDLIVEY
RKSIEDIVKIEP*

DNA
ATGCAGCAATTTCAGCAATTCCAACAACAGCAACACTTCATTCAACAACAGCAATACCAACAACAACAACAACAGCAACA
ACGCTTGTTACAATCTCCTCCTCTTCCTCAGCCGCAGCAGTCGTTGCAATCGCCTCCGCCACAGCAGACGGTGGTTCATA
CGCCTCAATCAATGATGCATACACCGCAACAACAGCAACAGTTGGTGCAGACTCCGCAACAGCATCAGTCTTTAGCTTCT
CACTTCCATCTTTATCCGATGGTGGAGAAATTAACCGATGCCATTGAAAATGGAACACGAGATCAGAATTCTGATGCCCT
GGTGACTGAATTGAATAGCCATTTCGAAAAGTGTCAGCAGTTGCTGAATTCGATTTCAGGATCGCTAGGATCTAAGACTA
TGACTGTTGATGGCCAAAAGAGAAATGTAGAAGAGAGTGAGCAGTTGCTTCAACAAAGAAGGGATTTGATTGTGGAGTAT
AGGAAATCTATTGAAGATATTGTCAAGATCGAGCCTTAG