Details for Capsella Locus Carubv10010146m

Position : scaf_1 ( 5`- 19118405 .. 19122704 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10010146m

Protein [Map View]
MAILSASSTIVRAALDTQPKLRYNPNAPRNVKKTPNLSSFVPPPSPSSSSPATNLTTEASVSASDLLKRPASKDIGDGFD
DPCIGYEKWFPSPPKVEKPRSVFNAASLAYIGDSIYEIYARRHFLFPPLSIEEYNDRVRAVVRCEAQYALLQKLVDDDFL
TKDERDVLRWGKNVGSVKTRSTRRAGVAVYNKASSLETLIGYLYLSNGKRLEEMMQKLGFSSGSSTERMIKEAKHKLSFK
*

DNA
ATGGCGATTTTATCAGCGAGCTCTACTATCGTGAGAGCTGCTTTAGATACACAGCCGAAGCTCCGATACAATCCCAATGC
GCCGCGAAACGTTAAGAAAACCCCTAATTTGAGCTCTTTTGTGCCACCACCGTCTCCGTCGTCATCTTCTCCGGCGACAA
ACTTAACAACTGAAGCAAGCGTCTCCGCTTCTGATTTGCTCAAACGTCCCGCAAGCAAAGACATTGGTGATGGATTTGAT
GATCCTTGTATTGGATATGAGAAATGGTTTCCAAGTCCACCAAAAGTGGAGAAACCTAGATCTGTTTTCAATGCTGCTTC
TTTAGCTTATATAGGCGATTCAATCTACGAGATATATGCTCGTCGGCATTTTCTTTTCCCTCCACTTAGTATCGAAGAAT
ATAACGACCGTGTTAGAGCAGTGGTTCGATGTGAAGCACAGTATGCTTTGTTGCAGAAGCTTGTTGATGATGATTTCTTA
ACGAAAGATGAAAGAGATGTCCTCCGGTGGGGAAAAAATGTAGGCTCGGTTAAAACACGGTCAACTAGGCGTGCTGGTGT
GGCTGTTTACAACAAGGCCTCATCATTGGAAACACTAATTGGATATCTGTATCTATCTAACGGGAAAAGATTGGAAGAAA
TGATGCAGAAGCTAGGATTTTCAAGTGGTTCTTCAACAGAGAGAATGATTAAAGAGGCCAAGCATAAACTATCTTTTAAA
TAA