Details for Capsella Locus Carubv10009988m

Position : scaf_1 ( 5`- 19127995 .. 19129720 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10009988m

Protein [Map View]
MSGRNRIHRDSYHDHRRDLPPERPFLRGPPLLQPPPPSLLDDLQIQEVEIRRLLNDNHRLAEDRMVLERELGAAKEELHR
MNLMISDLRAEQDLRSREFSEKRHQLEGDLRAMESYKKEASQLRAELQKLNDVKRGLSGDVQILRKDLAKLQSDNKQIPG
MRAEVKDLQKELMLARDAIDYEKKEKFELMEQRQTMEKNMVSMAREVEKLRAELATVDSRPWGFGGSYGMNYNSSDGAYR
GSYVENDSFLGSSERSQYYSHGSGSQKKPRLDRH*

DNA
ATGTCTGGAAGAAATCGAATTCACCGAGACAGTTATCATGATCATCGGCGTGATTTGCCTCCGGAGAGACCCTTTCTCCG
AGGCCCTCCATTGTTACAGCCTCCTCCACCATCTTTGTTAGATGATCTTCAGATACAGGAGGTTGAAATTAGAAGGCTTT
TGAATGATAATCACAGACTTGCTGAGGACCGAATGGTTTTGGAGCGAGAACTCGGTGCTGCTAAGGAAGAGCTTCACCGA
ATGAATCTCATGATCTCTGATCTTCGTGCTGAACAAGACCTGCGGTCGAGGGAGTTCAGTGAGAAAAGGCATCAACTTGA
GGGGGATCTTCGTGCTATGGAGTCTTATAAGAAGGAGGCTTCCCAGTTGCGTGCTGAACTTCAGAAGCTAAATGACGTTA
AACGTGGATTAAGTGGAGATGTTCAGATACTTAGGAAAGATCTGGCTAAATTGCAATCAGATAACAAGCAGATTCCCGGT
ATGCGAGCTGAGGTTAAAGATCTGCAGAAGGAGCTTATGCTGGCTAGAGATGCAATTGACTATGAAAAGAAGGAAAAATT
TGAGCTTATGGAGCAGCGGCAGACAATGGAAAAGAATATGGTCTCTATGGCGCGCGAAGTTGAAAAGCTACGAGCAGAAC
TTGCTACTGTTGATAGTAGGCCGTGGGGTTTTGGTGGATCATATGGGATGAATTACAACAGTTCGGATGGCGCTTACCGT
GGTTCTTATGTCGAAAATGATAGTTTTTTGGGATCTTCGGAAAGGAGTCAATATTACAGCCATGGGTCTGGCTCACAGAA
GAAGCCTCGCTTGGATCGCCACTGA